Recombinant Human T-cell acute lymphocytic leukemia protein 1 (TAL1), partial

Code CSB-EP023110HU1a2
Abbreviation Recombinant Human TAL1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TAL1
Uniprot No.
Research Area
Cancer
Alternative Names
Class A basic helix-loop-helix protein 17;Stem cell protein;T-cell leukemia/lymphoma protein 5
Source
E.coli
Expression Region
180-253aa
Target Protein Sequence
DGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.7 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.
Gene References into Functions
  1. HOPX is functionally regulated by SCL in hematoendothelial differentiation of mesoderm progenitor cells. PMID: 28813672
  2. NF-E2, TAL1 and KLF1, all activators play a primary role in HSs formation in the LCR PMID: 27026582
  3. mutations of SF3B1 may block erythropoiesis via dysregulation of alternative RNA splicing of transcription factor TAL1 PMID: 28545085
  4. a novel role of FOXP3 as a tumor suppressor in T-ALL through modulation of TAL1 transcriptional activity. PMID: 26686090
  5. Review emphasizes recent findings that shed light into the intricacies of TAL1 (epi)genetic regulation and the transcription network orchestrated by this major T-cell oncogene.[reiew] PMID: 27443261
  6. Deletions of TAL1 is associated with acute T-lymphoblastic leukemia. PMID: 27759908
  7. SCL/TAL1 (stem cell leukemia/T-cell acute lymphoblastic leukemia [T-ALL] 1) is an essential transcription factor in normal and malignant hematopoiesis. PMID: 28179281
  8. Upregulation of TAL1 is associated with T-cell acute lymphoblastic leukemia. PMID: 26882564
  9. Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells. PMID: 27052461
  10. analysis of a point mutation that increases fetal globin expression through de novo recruitment of the activator TAL1 to promote chromatin looping of distal enhancers to the modified gamma-globin promoter PMID: 25971621
  11. a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression. PMID: 26053062
  12. SCL-mediated transcriptional network enhances megakaryocytic specification of human embryonic stem cells. PMID: 25292191
  13. These results indicate that KLF1 plays a role in facilitating and/or stabilizing GATA-1 and TAL1 occupancy in the erythroid genes, contributing to the generation of active chromatin structure such as histone acetylation and chromatin looping PMID: 25528728
  14. Scl binds to primed enhancers in mesoderm to regulate hematopoietic and cardiac fate divergence. PMID: 25564442
  15. SCL/TAL1 is located in the up-stream of MEK/ERK pathway and partially regulates hematopoiesis by modulating the phosphorylation level of the key proteins in MEK/ERK pathway. PMID: 24405580
  16. study found that heterozygous somatic mutations are acquired that introduce binding motifs for the MYB transcription factor in a precise noncoding site, which creates a super-enhancer upstream of the TAL1 oncogene; MYB binds to this new site PMID: 25394790
  17. The results indicate that TAL1 plays a critical role in chromatin loop formation between the gamma-globin genes and locus control region, which is a critical step for the transcription of the gamma-globin genes. PMID: 24470145
  18. SIL-TAL1 rearrangement identifies a distinct subtype with inferior outcome which could allow for individual therapeutic stratification for T-ALL patients. PMID: 24040098
  19. our study reveals a novel molecular mechanism involving changes in three-dimensional chromatin interactions that activate the TAL1 oncogene in human T-cell leukemia. PMID: 23698277
  20. TAL1 is involved in regulating H3K27me3 variations in collaboration with GFI1B PMID: 24395799
  21. There is occurrence of TAL1 and MYC translocations in early thymocyte ontogeny, but subsequent oncogenic alterations were required to drive oncogenesis in T-cell acute lymphoblastic leukemia. PMID: 24249258
  22. These findings redefine how TAL1 and neighboring genes communicate within the nucleus, and indicate that looping facilitates both normal and aberrant TAL1 expression and may predispose to structural rearrangements in T-cell acute lymphoblastic leukemia. PMID: 24200685
  23. The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia. PMID: 23857984
  24. We validate a small set of TAL1-regulated microRNA genes whose role is important in T-cell acute lymphoblastic leukemia. PMID: 23448994
  25. Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells. PMID: 23327922
  26. Consistent with the dual roles of TAL1 in transcription, TAL1-associated LSD1 is decreased while recruitment of hSET1 is increased at the TAL1 targets during erythroid differentiation PMID: 22310283
  27. TAL1 binds to the EPO-R promoter to activate EPO-R expression PMID: 22982397
  28. a novel role for GATA-4 and TAL1 to affect skeletal myogenic differentiation and EPO response via cross-talk with Sirt1. PMID: 22773876
  29. TAL1 forms a positive interconnected autoregulatory loop with GATA3 and RUNX1 and that the TAL1 complex directly activates the MYB oncogene. PMID: 22897851
  30. The association between single nucleotide polymorphisms (SNPs) of the TAL1 gene, one of the candidate genes of leukemia and schizophrenia, is reported. PMID: 21407147
  31. SCL was the 11th most upregulated transcript during the first 4 days of the human embryonic stem cells differentiation process. PMID: 21937587
  32. results indicate that the HDACi-mediated apoptotic program in T-ALL cells is partially dependent on their capacity to downregulate TAL1 and provide support for the therapeutic use of HDACi in T-ALL PMID: 21647153
  33. The genome-wide binding sites for the SCL in primary human megakaryocytes to identify the essential regulator of complex mammalian differentiation processes. PMID: 21571218
  34. TAL1 interacts with RUNX1 and ETS1, and that these transcription factors are critically required for TAL1 binding to genes that modulate T-cell differentiation. PMID: 21179004
  35. in human TAL1-expressing T-ALL cell lines, TAL1 directly activates NKX3.1 PMID: 20855495
  36. Data open up several areas for further investigation and adds new layers of complexity to our understanding of the regulation of SCL expression. PMID: 20140202
  37. TAL-1, a basic-helix-loop-helix transcription factor, plays a key role in the formation and functioning of both blood and endothelial systems. Review. PMID: 19527627
  38. Tal1 expression activated UBE2H expression, whereas Tal1 knock-down reduced UBE2H expression and ubiquitin transfer activity. PMID: 20028976
  39. Generated high-level hematopoietic chimeras using donor cells from mice transgenic for the stem cell leukaemia 3' enhancer human placental alkaline phosphatase reporter construct to demonstrate vascular contribution potential of fetal liver cells. PMID: 19785037
  40. role of hypoxia in stimulating phosphorylation, ubiquitination, and proteasomal breakdown in endothelial cells PMID: 11904294
  41. SCL locus can rescue knockout scl(-/-) mice PMID: 12010791
  42. Ectopic expression of human TAL-1 protein in Ly-6E.1-htal-1 transgenic mice induces defects in B- and T-lymphoid differentiation, but did not cause leukemia. PMID: 12091340
  43. regulates c-kit expression in hematopoietic cells through functional interaction with Sp1 PMID: 12239153
  44. is a survival factor for erythroid cells PMID: 12867998
  45. These results indicate that TAL1 can affect both T cell proliferation and differentiation. PMID: 14651981
  46. Enforced expression of a TAL1 protein deleted of its DNA-binding domain mimicked most TAL1 effects except for the LTC-IC enhancement, the down-regulation of the CD34 surface marker, and the GPA(+) cell production PMID: 14715640
  47. TAL-1 modulates the angiogenic response of endothelial cells by stimulating cell morphogenesis and by influencing their behavior in migration. PMID: 14970264
  48. Possible role for SCL in renal vasculogenesis. Undifferentiated mesenchymal cells expressing SCL during early nephrogenesis might represent putative progenitors that can simultaneously give rise to kidney, blood, and endothelium. PMID: 15086455
  49. Tal1/SCL binding to pericentromeric DNA represses transcription PMID: 15677454
  50. Results show striking coexpression of SCL and its immediate downstream neighbor, MAP17, suggesting that they share regulatory elements. PMID: 15923636

Show More

Hide All

Involvement in disease
A chromosomal aberration involving TAL1 may be a cause of some T-cell acute lymphoblastic leukemias (T-ALL). Translocation t(1;14)(p32;q11) with T-cell receptor alpha chain (TCRA) genes.
Subcellular Location
Nucleus.
Tissue Specificity
Leukemic stem cell.
Database Links

HGNC: 11556

OMIM: 187040

KEGG: hsa:6886

STRING: 9606.ENSP00000294339

UniGene: Hs.705618

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*