Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
TRBC2; TCRBC2; T cell receptor beta constant 2
Species
Homo sapiens (Human)
Expression Region
1-129aa
Target Protein Sequence
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Human TRBC2 protein started with the TRBC2 gene synthesis. And then using recombinant DNA technology, the TRBC2 gene was inserted into an expression vector so that we could get the recombinant express plasmid of TRBC2. Transform the plasmid into the cells of E.coli, culture the cells and we could get the desired Recombinant Human TRBC2 protein. But the work was not completed, protein purification and a strict QC system were performed in the last step. The purity is 85%+ determined by SDS-PAGE.
TRBC2 (also named TCRBC2) is a gene providing an instruction of making a protein named T cell receptor beta constant 2 (TRBC2) in human. TRBC2 protein can bind to antigen and immunoglobulin receptor and is involved multiple biological processes. These processes include B cell receptor signaling pathway, complement activation, classical pathway, defense response to bacterium, innate immune response, positive regulation of B cell activation, etc.