Recombinant Human Tenascin-X (TNXB)

Code CSB-YP024036HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP024036HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP024036HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP024036HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TNXB
Uniprot No.
Alternative Names
EDS3; Ehlers Danlos like syndrome; Growth inhibiting protein 45; Hexabrachion like protein; Hexabrachion-like protein; HXBL; NXB2; Tenascin X; Tenascin X precursor; Tenascin XB; Tenascin XB1; Tenascin XB2; Tenascin-X; TENX; TENX_HUMAN; TN X; TN-X; TNX; TNXB; TNXB1; TNXB2; TNXBS; VUR8; XB; XBS
Species
Homo sapiens (Human)
Expression Region
1-673
Target Protein Sequence
MRLSWSVAQGPFDSFVVQYEDTNGQPQALLVDGDQSKILISGLEPSTPYRFLLYGLHEGK RLGPLSAEGTTGLAPAGQTSEESRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGV PSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART LSPVLESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQLADGGEPQSVQVDGQARTQK LQGLIPGARYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTEGFAVLHWKPPQNP VDTYDVQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTT GLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSHQLLGL FPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGN RERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLT QAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSAR DRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMK LRPRNFRSPAGGG
Protein Length
Full length protein of Isoform 2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Appears to mediate interactions between cells and the extracellular matrix. Substrate-adhesion molecule that appears to inhibit cell migration. Accelerates collagen fibril formation. May play a role in supporting the growth of epithelial tumors.
Gene References into Functions
  1. mRNA for tenascin-X gene values was higher in ventricular septal defects. PMID: 29470764
  2. Hypermethylated sites at TNXB are associagted with response to starvation in anorexia nervosa. PMID: 27367046
  3. Study describes a biallelic TNXB variants in patients with congenital adrenal hyperplasia due to CYP21A2 deletions resulting in a classical Ehlers-Danlos syndrome phenotype with skin hyperextensibility, widened atrophic scars and joint hypermobility. PMID: 27297501
  4. patients with the TNX-deficient type EDS typically have generalized joint hypermobility, skin hyperextensibility and easy bruising. In contrast to the classical type, the inheritance pattern is autosomal recessive and atrophic scarring is absent. Molecular analysis of TNXB in a diagnostic setting is challenging. PMID: 27582382
  5. the identification of a rare missense variant in TNXB in combination with a positive family history of VUR and joint hypermobility may represent a non-invasive method to diagnose PVUR and warrants further evaluation in other cohorts PMID: 26408188
  6. We then quantified the tenascin-X level in serum of patients and identified tenascin-X as potent marker for ovarian cancer, showing that secretomic analysis is suitable for the identification of protein biomarkers when combined with protein immunoassay. PMID: 26090390
  7. It plays regulatory roles in collagen functions such as fibril organization and fibrillogenesis in calcific aortic valves. PMID: 25926574
  8. these results suggest that mutations in TNXB can cause hereditary primary vesicoureteral reflux . PMID: 23620400
  9. Noticeable decreased expression of tenascin-X in calcific aortic valves. PMID: 22827484
  10. Tenascin-X haploinsufficiency was associated with Ehlers-Danlos syndrome in patients with congenital adrenal hyperplasia PMID: 23284009
  11. no difference in genotype frequency was detected between patients who experienced a re-dislocation after the initial surgery and patients who did not sustain a re-dislocation. PMID: 22991340
  12. Genome-wide association study of age-related macular degeneration identifies TNXB, FKBPL and NOTCH4 as candidate susceptibility genes. PMID: 22694956
  13. Combined analysis of tenascin-C expression and the nodule size improved the prediction of malignancy in this patient cohort. PMID: 22588153
  14. rs204887 itself or a nearby variant is unlikely to play a major role in the development of schizophrenia although a cumulative contribution of rare variants in the TNXB gene cannot be ruled out. PMID: 21317684
  15. Three point mutations in TNX gene were found to be associated with hypermobility type Ehlers-Danlos syndrome (EDS) . The phenotypic effects of V1195M mutation on 7th fibronectin Type III domain (TNXfn7) with regards to EDS were investigated. PMID: 20853426
  16. localization and analysis of the principal promoter for human tenascin-X PMID: 12376099
  17. chromosomal mapping of a de novo unequal crossover causing a deletion of the steroid 21-hydroxylase gene and a non-functional hybrid tenascin-X gene PMID: 12746407
  18. The transmission disequilibrium test did not show allelic association between these two TNXB single nucleotide polymorphisms and schizophrenia, and the rs1009382-rs204887 haplotypes were not associated with the illness either. PMID: 14729256
  19. Both elastic fiber abnormalities and reduced collagen content contribute to the observed phenotype in TNX-deficient patients. PMID: 15102077
  20. different distributions of tenascin-C and -X were found around the epithelium and the endomysium of the mental symphyseal region, and affect the specific formation of the mandible during ossification in the fetus PMID: 15455729
  21. elastic fiber abnormalities in hypermobility type Ehlers-Danlos syndrome are specific for TNX-haploinsufficient individuals and confirm an important role for TNX in regulating elastic fiber integrity PMID: 15733269
  22. Tenascin-X expression is markedly decreased in AAA tissue, and AAA is associated with high serum concentrations of tenascin-X. PMID: 16567571
  23. TNX contributes to matrix stability and is possibly involved in collagen fibril formation. PMID: 17033827
  24. Association of the TNXB locus or its adjacent region of the NOTCH4 locus with schizophrenia. PMID: 17192952
  25. TNXB and TNC may be involved in the malignant transformation of plexiform neurofibromas PMID: 17202312
  26. Multiple species of TNX in blood were identified and characterized. PMID: 17263730
  27. TNX is unlikely to be involved in matrix deposition in the early phase of wound healing, but it is required in the later phase when remodeling and maturation of the matrix establishes and improves its biomechanical properties. PMID: 17453911
  28. TNXB(tenascin XB protein) gene is a candidate gene susceptible to Systemic lupus erythematosus in the Japanese population. PMID: 18058064
  29. This study showed different patterns of expression of tenascin and fibronectin along the process of tumorigenesis and tumor progression in pleomorphic adenoma, a fact that might play a role in invasion properties of these tumors. PMID: 18091320
  30. Data indicate a complex architecture of the extracellular matrix in the uterosacral ligaments, with marked differences in tenascin and elastin expression between postmenopausal women with or without pelvic organ prolapse. PMID: 18155129
  31. TNX-deficient women are at risk of obstetric complications. PMID: 18335242
  32. These results suggest possible involvement of XB-S in the function of Eg5. PMID: 18679583
  33. Tenascin-X may be a new diagnostic marker of malignant mesothelioma in the differential diagnosis of cancers involving the serosal cavities. PMID: 19738457

Show More

Hide All

Involvement in disease
Ehlers-Danlos syndrome due to tenascin X deficiency (EDSTNXD); Vesicoureteral reflux 8 (VUR8)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Tenascin family
Tissue Specificity
Highly expressed in fetal adrenal, in fetal testis, fetal smooth, striated and cardiac muscle. Isoform XB-short is only expressed in the adrenal gland.
Database Links

HGNC: 11976

OMIM: 600985

KEGG: hsa:7148

STRING: 9606.ENSP00000407685

UniGene: Hs.485104

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1