Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

TSPAN7

Uniprot No.

P41732

Research Area

Immunology

Alternative Names

A15; CCG B7; CD231; CD231 antigen; Cell surface glycoprotein A15; DXS1692E; Membrane component chromosome X surface marker 1; Membrane component X chromosome surface marker 1; MRX58; MXS1; T cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; TALLA 1; TALLA; TALLA-1; TALLA1; Tetraspanin 7; Tetraspanin-7; TM4SF2; TM4SF2b; Transmembrane 4 superfamily 2b; Transmembrane 4 superfamily member 2; Transmembrane protein A15; TSN7_HUMAN; Tspan 7; Tspan-7; TSPAN7

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

113-213aa

Target Protein Sequence

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.6kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human TSPAN7 was expressed with the amino acid range of 113-213. The theoretical molecular weight of the TSPAN7 protein is 15.6 kDa. Expression of this TSPAN7 protein is conducted in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of TSPAN7, which enables a simple process of detecting and purifying the TSPAN7 recombinant protein in the following steps.

Tetraspanin-7 (TSPAN7) is widely expressed in tissues throughout the body and is particularly prominent in the nervous system. It is a key component of tetraspanin-enriched microdomains (TEMs) or tetraspanin webs, where it interacts with other membrane proteins to regulate signal transduction, cell adhesion, and membrane organization. Research indicates that TSPAN7 plays essential roles in neuronal development and function. It has been implicated in neurite outgrowth, synaptogenesis, and the formation of neuronal circuits. TSPAN7's interactions with other proteins, including integrins and growth factor receptors, suggest its involvement in modulating cell adhesion and signaling pathways critical for neural development. Furthermore, mutations in the TSPAN7 gene have been associated with X-linked intellectual disability (XLID), highlighting its importance in cognitive function.

Target Background

Function

May be involved in cell proliferation and cell motility.

Gene References into Functions

These results disclosed a previously uncharacterized role of TSPAN7 in the regulation of the expression and functional activity of DRD2 by postendocytic trafficking. PMID: 28223337
The role of TSPAN7 in immune system response to HIV-1 is reviewed. TSPAN7 appears to be a positive regulator of actin nucleation and stabilization, through the ARP2/3 complex. By doing so, TSPAN7 limits HIV-1 endocytosis and maintains viral particles on actin-rich dendrites for an efficient transfer toward T lymphocytes. PMID: 28620031
Elevated TSPAN7 may be associated with better outcomes for multiple myeloma patients. PMID: 25637218
Loss of TSPAN7 is associated with metastasis in clear-cell renal cell carcinoma. PMID: 22213152
This study identified that TSPAN7 as a key molecule for the functional maturation of dendritic spines via PICK1 and ampa receptor trafficking. PMID: 22445342
TM4SF2 was identified as a putative antigenic target in Wegener's granulomatosis PMID: 20951001
Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system. PMID: 20850477
The interaction of VP26 with tetraspanin-7 plays an essential role in normal HSV-1 replication. PMID: 20630051
associated with spermatozoa PMID: 19535787
The role of TMSF2 in mental retardation PMID: 14735593
coding mutations in TSPAN7 are not associated with our cohort of autism patients PMID: 19339915

Hide All

Involvement in disease

Mental retardation, X-linked 58 (MRX58)

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

Tetraspanin (TM4SF) family

Tissue Specificity

Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.

Database Links

HGNC: 11854

OMIM: 300096

KEGG: hsa:7102

STRING: 9606.ENSP00000367743

UniGene: Hs.441664

Code	CSB-EP025165HU
Abbreviation	Recombinant Human TSPAN7 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tetraspanin-7 (TSPAN7), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage