Recombinant Human Tetraspanin-7 (TSPAN7), partial

In Stock
Code CSB-YP025165HU
Abbreviation Recombinant Human TSPAN7 protein, partial
MSDS
Size $250
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TSPAN7
Uniprot No.
Research Area
Immunology
Alternative Names
A15; CCG B7; CD231; CD231 antigen; Cell surface glycoprotein A15; DXS1692E; Membrane component chromosome X surface marker 1; Membrane component X chromosome surface marker 1; MRX58; MXS1; T cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; TALLA 1; TALLA; TALLA-1; TALLA1; Tetraspanin 7; Tetraspanin-7; TM4SF2; TM4SF2b; Transmembrane 4 superfamily 2b; Transmembrane 4 superfamily member 2; Transmembrane protein A15; TSN7_HUMAN; Tspan 7; Tspan-7; TSPAN7
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
113-213aa
Target Protein Sequence
RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in cell proliferation and cell motility.
Gene References into Functions
  1. These results disclosed a previously uncharacterized role of TSPAN7 in the regulation of the expression and functional activity of DRD2 by postendocytic trafficking. PMID: 28223337
  2. The role of TSPAN7 in immune system response to HIV-1 is reviewed. TSPAN7 appears to be a positive regulator of actin nucleation and stabilization, through the ARP2/3 complex. By doing so, TSPAN7 limits HIV-1 endocytosis and maintains viral particles on actin-rich dendrites for an efficient transfer toward T lymphocytes. PMID: 28620031
  3. Elevated TSPAN7 may be associated with better outcomes for multiple myeloma patients. PMID: 25637218
  4. Loss of TSPAN7 is associated with metastasis in clear-cell renal cell carcinoma. PMID: 22213152
  5. This study identified that TSPAN7 as a key molecule for the functional maturation of dendritic spines via PICK1 and ampa receptor trafficking. PMID: 22445342
  6. TM4SF2 was identified as a putative antigenic target in Wegener's granulomatosis PMID: 20951001
  7. Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system. PMID: 20850477
  8. The interaction of VP26 with tetraspanin-7 plays an essential role in normal HSV-1 replication. PMID: 20630051
  9. associated with spermatozoa PMID: 19535787
  10. The role of TMSF2 in mental retardation PMID: 14735593
  11. coding mutations in TSPAN7 are not associated with our cohort of autism patients PMID: 19339915

Show More

Hide All

Involvement in disease
Mental retardation, X-linked 58 (MRX58)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.
Database Links

HGNC: 11854

OMIM: 300096

KEGG: hsa:7102

STRING: 9606.ENSP00000367743

UniGene: Hs.441664

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*