Recombinant Human Thymosin beta-10 (TMSB10)

In Stock
Code CSB-EP023931HU
Abbreviation Recombinant Human TMSB10 protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TMSB10
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-44aa
Target Protein Sequence
ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Gene References into Functions
  1. TMSB10 may hold promise as a minimally invasive serum cancer biomarker for the diagnosis of breast cancer and a potential therapeutic target which will facilitate the development of a novel therapeutic strategy against breast cancer. PMID: 28179017
  2. High expression of thymosin beta 10 is associated with hepatocellular carcinoma. PMID: 25037578
  3. High expression levels of TMSB10 correlated with lymphatic metasttases in papillary thyroid carcinoma, especially in the central neck region. PMID: 24974154
  4. Regarding HCC, Tbeta4 reactivity was detected in 7/23 cases (30%) and Tbeta10 reactivity in 22/23 (97%) cases analyzed, adding HCC to human cancers that express these beta-thymosins. PMID: 24704991
  5. Low expression of Tbeta10 is associated with metastatic phenotype of CCA in vitro and in vivo. PMID: 24053380
  6. The results show, for the first time, a strong expression of thymosin beta 10 in the human salivary glands during the initial phases of the physiological development, present at the 13th week of gestation, and suggesting a role for the peptide in the salivary glands' organogenesis. PMID: 21733645
  7. Thymosin beta10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production. PMID: 22623951
  8. Amplification of thymosin beta 10 is associated with metastatic and aggressive papillary thyroid carcinomas. PMID: 22161024
  9. hypomethylation of the promoter is not associated with its overexpression in non-small cell lung cancer PMID: 22038593
  10. Describe beta-thymosins in bronchoalveolar lavage fluid and their possible involvement in the pathogenesis of scleroderma lung disease. PMID: 21314931
  11. The expression of Tbeta10 in the human kidney during the initial phases of its physiological development, mainly restricted in the proximal and the distal tubuli. PMID: 20836742
  12. TB10 plays a critical role in the regulation of anchorage-independent growth and assembly of actin filaments. PMID: 12481941
  13. Introduction of E-Tmod cDNA into a tumor cell line reverses TB10 mediated apoptosis and restored actin architectures. PMID: 14741341
  14. TB10 has a role in progression of human thyroid carcinomas, particularly in the anaplastic histotypes PMID: 15254683
  15. Inhibition of Ras signal transduction by thymosin beta(10) results in antiangiogenic and antitumor effects, suggesting that thymosin beta(10) may be valuable in anticancer therapy. PMID: 15665289
  16. results strongly suggest that Thr20 is specifically required for actin sequestration by TB10 in ovarian cancer cells PMID: 16012174
  17. the distribution of staining for thymosin beta10 was inverse of staining for F-actin. These data support a physiological role for thymosin beta10 in sequestration of G-actin as well as in cancer cell motility. PMID: 16786322
  18. Expression of TB10 and its role in non-small cell lung cancer are reported. PMID: 18789485
  19. Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation. PMID: 19194824
  20. outlines for the first time that salivary glands during foetal life express and secrete peptides such as beta-thymosins probably involved in the development of the oral cavity and its annexes PMID: 19337364

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
Thymosin beta family
Database Links

HGNC: 11879

OMIM: 188399

KEGG: hsa:9168

STRING: 9606.ENSP00000233143

UniGene: Hs.446574

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*