Name: Recombinant Human Transcription factor PU.1 (SPI1)
Brand: CUSABIO
SKU: CSB-EP022567HU

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SPI1

Uniprot No.

P17947

Research Area

Immunology

Alternative Names

transcription factor spi1; 31 kDa Transforming Protein; 31 kDa-transforming protein; cb1086; Hematopoietic transcription factor PU.1; OF; oncogene spi1; PU.1; SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of; SFPI1; si:by184l24.2; SPI 1; SPI 1 proto oncogene; SPI A; Spi1; SPI1_HUMAN; Spleen focus forming virus (SFFV) proviral integration oncogene spi1; Spleen focus forming virus proviral integration oncogene spi1; Transcription factor PU.1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-270aa

Target Protein Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To make this Recombinant Human SPI1 protein, the SPI1 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human SPI1 protein was developed in the platform. It was expressed in E.coli at the region of 1-270aa of the Human SPI1 protein. N-terminal 6xHis tag was fused with the expression vector for affinity and purification purposes. The purity is 85%+ determined by SDS-PAGE.

SPI1 gene encodes the hematopoietic master TF PU.1. Previous studies define the clinical and molecular phenotype of this novel inherited PU.1 haploinsufficiency syndrome, which they term PU.1-mutated agammaglobulinemia (PU.MA). PU.1 is a key transcriptional regulator required in the development of multiple hematopoietic lineages. Somatic mutations in SPI1 have been reported in the context of acute myeloid leukemia. However germline variants impacting human SPI1 have not been previously identified. Mouse models of Spi1-deficient hematopoiesis indicate a crucial role for PU.1 in early lineage commitment, differentiation of multiple myeloid lineages, as well as B cell development. However, the precise effect of SPI1 loss on human hematopoiesis has remained unknown. PU.1 has been shown to have multifaceted roles in hematopoiesis, with reduced PU.1 levels causing B cell developmental arrest, but other specific PU.1 perturbations can favor B cell over myeloid lineage development.

Target Background

Function

Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.

Gene References into Functions

these results suggest that attenuating PU.1 may be a valid therapeutic approach to limit microglial-mediated inflammatory responses in Alzheimer's disease PMID: 30124174
PU.1 3'UTR attenuates TNFalphainduced proliferation and cytokine release of RAFLS by acting as a ceRNA for FOXO3 to regulate miR155 activity. PMID: 29693176
Inhibition of endogenous miR-155 in B cells of rheumatoid arthritis patients restores PU.1 and reduces production of antibodies. PMID: 27671860
PU.1 binds to OX40L promoter in dendritic cells. PMID: 27708417
These results bring indirect evidence that leukemia develops from cells which have bypassed Spi1-induced senescence. Overall, our results reveal senescence as a Spi1-induced anti-proliferative mechanism that may be a safeguard against the development of acute myeloid leukemia. PMID: 28912174
In contrast, expression of Spi1/PU.1 in a Fli1 producing erythroleukemia cell line in which fli1 is activated, resulted in increased proliferation through activation of growth promoting proteins MAPK, AKT, cMYC and JAK2 PMID: 28586009
Data show that protein phosphatase-1 alpha (PP1alpha) is required to maintain checkpoint kinase 1 (CHK1) in a dephosphorylated state and for the accelerated replication fork progression in Spi1/PU.1 transcription factor-overexpressing cells. PMID: 28415748
the results indicate that PU.1 may be a critical factor for the innate defense against A. fumigatus, and may therefore be a potential target for the prophylaxis and treatment of IPA. PMID: 28440496
PU.1 supports TRAIL-induced cell death by inhibiting RelA-mediated cell survival and inducing DR5 expression. PMID: 28362429
PU.1 directly activates the expression of HOTAIRM1 through binding to the regulatory region of HOTAIRM1 during granulocytic differentiation. PMID: 27146823
PU.1 and IL-9 may play a role in AD pathogenesis and relate to disease severity and clinical eruption types. PMID: 28229452
PU.1 has a role in tumor suppression in PEL and its down-regulation is associated with PEL development. PMID: 28481873
PU.1-induced apoptosis in myeloma cells is associated with IRF4 downregulation and subsequent IRF7 upregulation. PMID: 28368411
Most cases of histiocytic sarcoma expressed histiocytic markers CD68 (6 of 7 cases), CD163 (5 of 5 cases), and PU.1 (3 of 4 cases). PMID: 28805986
findings highlight a unique role of SPI1 fusions in high-risk pediatric T cell acute lymphoblastic leukemia PMID: 28671687
Alzheimer's disease heritability was enriched within the PU.1 cistrome, implicating a myeloid PU.1 target gene network in AD. PMID: 28628103
expression of an essential mediator of neutrophil terminal differentiation, the ets transcription factor PU.1, was significantly decreased in Hbb(th3/+) neutrophils in beta-thalassemia PMID: 28325862
RUNX1 overexpression induced partial DNA demethylation at SPI1 proximal promoter. PMID: 28376714
This study demonstrated the novel role of PU.1 in the immune response to A. fumigatus through upregulation of Dectin-1 expression and its translocation to the nucleus in A. fumigatus-stimulated THP-1 cells. PMID: 27306059
PU.1 is an important modulator of VDR signaling in monocytes. PMID: 28232093
Forced FOG1 protein expression in K562 erythroleukemia cells induced the expression of SLC4A1 protein, but repressed that of transcription factor PU.1. PMID: 28216155
Moreover, the expression of a cell proliferation marker Ki67 was significantly decreased in tumors from the mice not taking doxycycline, compared with that of tumors from the mice continuously taking doxycycline. The present data strongly suggest that PU.1 functions as a tumor suppressor of myeloma cells in vivo. PMID: 28347818
we demonstrated that miR-22 promoted monocyte/macrophage differentiation, and MECOM (EVI1) mRNA is a direct target of miR-22 and MECOM (EVI1) functions as a negative regulator in the differentiation.The miR-22-mediated MECOM degradation increased c-Jun but decreased GATA2 expression, which results in increased interaction between c-Jun and PU.1 PMID: 27617961
we conclude that PU.1 transactivates the pIII through direct binding to Ets-motifs in the promoter in pDCs PMID: 27105023
Our results suggest the existence of a Vav1/PU.1/miR-142-3p network that supports all-trans retinoic acid -induced differentiation in acute promyelocytic leukemia -derived cells PMID: 27480083
Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages. PMID: 26942192
This study showed that HCV infection might abrogate NK cytotoxic potential through altering PU.1, NKG2D receptor and perforin molecules. PMID: 26429314
SPI1-GFI1B transcriptional network is an important regulatory axis in acute myeloid leukemia as well as in the development of erythroid versus myelomonocytic cell fate PMID: 26851695
The GATA-1-mediated inhibition of PU.1 gene transcription in human AML-erythroleukemias mediated through the URE represents important mechanism that contributes to PU.1 downregulation and leukemogenesis that is sensitive to DNA demethylation therapy PMID: 27010793
PU.1 downregulation was noted in B-CLL/SLL samples positive for the adverse prognostic markers CD38 and ZAP-70. PMID: 26261072
PU.1 recruitment coupled with increased histone acetylation induces gene expression and activates a monocyte/macrophage transcriptional programme. PMID: 26126967
This study demonstrated positive regulation of monocyte/macrophage differentiation by lnc-MC and uncovered an elaborate regulation mechanism composed of PU.1, lnc-MC, miR-199a-5p, and ACVR1B. PMID: 26149389
Collectively, IMiDs exert demethylation activity through inhibiting DNMT1, 3a, and 3b, and up-regulating PU.1 expression, which may be one of the mechanisms of the anti-myeloma activity of IMiDs. PMID: 26657848
Loss of PU.1 expression is associated with Hepatocellular Carcinoma. PMID: 25987019
PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation. PMID: 25072246
This review summarizes current knowledge and ideas of molecular mechanisms by which PU.1 controls hematopoiesis and suppresses leukemia. [review] PMID: 25205721
A novel network has been described in acute myeloid leukemia in which FLT3-ITD signaling induces oncogenic miR-155 by p65 and STAT5 thereby targeting transcription factor PU.1. PMID: 25092144
The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence. PMID: 25184385
Runx-dependent PU.1 chromatin interaction and transcription of PU.1 are essential for both normal and leukemia stem cells. PMID: 25185713
PU.1- targeted genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation. PMID: 24028770
DNA complex may be relevant to an emerging role of PU.1, but not Ets-1, as a pioneer transcription factor in vivo PMID: 24952944
Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts. PMID: 24498324
The PU.1-regulated MAP1S gene is implicated in neutrophil differentiation and autophagy control. PMID: 25043887
hnRNP K and PU.1 act synergistically during granulocytic differentiation, hnRNP K seems to have a negative effect on PU.1 activity during monocytic maturation PMID: 25005557
Data indicate that transcription factors RUNX1 and PU.1 cooperated to exchange corepressors for coactivators, and deficiency of RUNX1, frequent in leukemia, caused aberrant recruitment of specific corepressors instead of coactivators to PU.1. PMID: 24695740
IL-32theta; reduces PKCdelta-mediated phosphorylation of PU.1, resulting in attenuation of IL-1beta production PMID: 24996056
HSF1 appears as a fine-tuning regulator of SPI1/PU.1 expression at the transcriptional and post-translational levels during macrophage differentiation of monocytes. PMID: 24504023
our findings demonstrate that PU.1 contributes to the development of MLL leukemia, partially via crosstalk with the MEIS/HOX pathway. PMID: 24445817
Given the importance of C/EBPs and PU.1 in myeloid development, these results, thus, suggest that restoration of the normal function of the myeloid cell transcriptional machinery is a major molecular mechanism underlying the differentiation induction PMID: 24379003
Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis PMID: 24908389

Hide All

Subcellular Location

Nucleus.

Protein Families

ETS family

Database Links

HGNC: 11241

OMIM: 165170

KEGG: hsa:6688

STRING: 9606.ENSP00000227163

UniGene: Hs.502511

Code	CSB-EP022567HU
Abbreviation	Recombinant Human SPI1 protein
MSDS	MSDS Datasheet
Size	US$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022567HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPI1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022567HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPI1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Transcription factor PU.1 (SPI1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage