Recombinant Human Transcriptional adapter 3 (TADA3), partial

Code CSB-RP034944h
Abbreviation Recombinant Human TADA3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TADA3
Uniprot No.
Research Area
Transcription
Alternative Names
TADA3; ADA3; TADA3L; Transcriptional adapter 3; ADA3 homolog; hADA3; STAF54; Transcriptional adapter 3-like; ADA3-like protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-238aa
Target Protein Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.9kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Gene References into Functions
  1. These results reveal a novel RTK-AKT-p300-ADA3 signaling pathway involved in growth factor-induced cell cycle progression. PMID: 28759294
  2. PCAF and ADA3 transcriptionally regulate PACS1 and PACS1 is a key regulator of BAX/BAK oligomerization and the intrinsic (mitochondrial) pathway to apoptosis. PMID: 28060382
  3. ADA3 overexpression enhances cell proliferation that is associated with increased expression of c-MYC. Expression patterns with respect to ADA3/c-MYC can divide patients into four significantly different subgroups, with c-MYC High and ADA3 Low status independently predicting poor survival in patients. PMID: 27852327
  4. review on hADA3 with a comprehensive outlook on the molecular and functional roles of hADA3 PMID: 27605378
  5. Findings demonstrate that acetylation of ADA3 by its associated histone acetyltransferases is essential for its key role in histone acetylation and cell cycle progression. PMID: 27402865
  6. results thus demonstrate that the catalytic activity of GCN5 is stimulated by subunits of the ADA2a- or ADA2b-containing HAT modules and is further increased by incorporation of the distinct HAT modules in the ATAC or SAGA holo-complexes PMID: 26468280
  7. PCAF and ADA3 regulate Bid processing via PACS2, to modulate the mitochondrial cell death pathway in response to hGrzB. PMID: 24464226
  8. Cytoplasmic localization of alteration/deficiency in activation 3 (ADA3) predicts poor clinical outcome in breast cancer patients. PMID: 23288344
  9. Expression of the interacting proteins altered expression of an hADA3-regulated reporter gene, suggesting functional consequences for the interactions. PMID: 23167988
  10. a critical role of Ada3 in embryogenesis and cell cycle progression as an essential component of HAT complex. PMID: 22736770
  11. hADA3 interacts directly with RARalpha in a hormone-dependent manner and this interaction contributes to RARalpha transactivation PMID: 20413580
  12. Data identify hADA3, human homologue of the yeast transcriptional coactivator yADA3, as a novel human papillomavirus oncoprotein E6-interacting protein and a target of E6-induced degradation. PMID: 12138191
  13. Results demonstrate that human papilloma virus 16 E6 oncoprotein inhibits the RXR(alpha)-mediated transactivation of target genes, implying that perturbation of RXR-mediated transactivation by E6 could contribute to HPV oncogenesis. PMID: 12235159
  14. results demonstrate that transcriptional adaptor ADA3 protein directly binds to human estrogen receptor alpha and beta and enhances the transcription of estrogen receptor-responsive genes PMID: 15496419
  15. human Ada3 has an essential role in p53 acetylation PMID: 17272277
  16. p14ARF signals through hAda3 to stimulate p53 acetylation and the induction of cell senescence PMID: 17452980
  17. hADA2a and hADA3 as crucial cofactors of beta-catenin that are likely involved in the assembly of transactivation-competent beta-catenin complexes at Wnt target genes. PMID: 18059173
  18. Role of Ada3 in histone acetyltransferase recruitment to estrogen-responsive target gene promoters and for estrogen-dependent proliferation of breast cancer cells. PMID: 18089809
  19. The findings strongly imply that the inactivation of the p14ARF-p53 pathway, either by the E6-mediated degradation of p53 or hAda3 or by cellular adaptation, is required for MEC immortalization. PMID: 18256148
  20. ADA3 is a newly identified target of the ANCO proteins, which may modulate co-activator function in a transcription-factor-specific manner PMID: 18377363
  21. oncoprotein E6 inhibits hADA3 in cervical cancer cells and this process is E6AP-dependent. PMID: 19194825

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
NGG1 family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 19422

OMIM: 602945

KEGG: hsa:10474

STRING: 9606.ENSP00000307684

UniGene: Hs.386390

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*