Recombinant Human Transformer-2 protein homolog beta (TRA2B), partial

In Stock Promotion
Code CSB-EP021143HU1
MSDS
Size US$306
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP021143HU1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP021143HU1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TRA2B
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
arginine/serine-rich 10; Arginine/serine-rich splicing factor 10; hTRA2-beta; SFRS10; Splicing factor; Splicing factor arginine/serine rich 10; SRFS10; TRA-2 beta; TRA2-beta; Tra2b; TRA2B_HUMAN; TRAN2B; Transformer 2 beta homolog; Transformer-2 protein homolog B; Transformer-2 protein homolog beta; Transformer-2-beta
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
111-201aa
Target Protein Sequence
RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
26.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA.
Gene References into Functions
  1. Findings demonstrate that Tra2b is upregulated in non-small cell lung cancer (NSCLC) and is associated with poor prognosis. Furthermore, Tra2b was identified as a direct target of miR-335. These results indicate that the interaction between miR-335 and Tra2b may play a vital role in the pathogenesis of NSCLC. PMID: 29161765
  2. It seems that a new signaling axis, SIRT1-SFRS10-LPIN1 axis, acting in the pathogenesis of alcoholic fatty liver disease exists. PMID: 28467182
  3. that TRA2beta promotes glioma cell growth and migration, and could be a candidate for molecular targeting during gene therapy treatments of glioma PMID: 26298634
  4. Tra2beta was significantly upregulated in prostate carcinoma, and multivariate analysis confirmed Tra2beta as an independent prognostic factor. PMID: 26261585
  5. Overexpression of either Tra2alpha or Tra2beta results in a marked reduction in HIV-1 Gag/ Env expression. PMID: 25970345
  6. Results showed that HNRNPG and HTRA2-BETA1 were specific antagonistic regulators of ERa exon7 splicing and increased HNRNPG levels were associated with improved clinical outcome of endometrial cancer through up-regulation of ERaD7 expression. PMID: 25884434
  7. findings suggest that Tra2beta regulates apoptosis by modulating Bcl-2 expression through its competition with miR-204. This novel function may have a crucial role in tumor growth. PMID: 25342468
  8. SRPK1 is a regulator of Tra2beta1 splicing function and individual domains engage in considerable cross-talk, assuming novel functions with regard to RNA binding, splicing, and catalysis. PMID: 26013829
  9. Simultaneous depletion of Tra2alpha and Tra2beta induces substantial shifts in splicing of endogenous Tra2beta target exons, and both constitutive and alternative target exons are under dual Tra2alpha-Tra2beta control. PMID: 25208576
  10. Results indicate that transformer 2beta (Tra2beta) was involved in the tumorigenesis of NSCLC and might be a potential therapeutic target of non-small cell lung cancer (NSCLC). PMID: 24952301
  11. Facilitating Tra2beta-dependent inclusion of exons in target pre-mRNAs. PMID: 24865968
  12. Oxidative stress-responsive Transformer 2beta may play an important role in colon cancer growth. PMID: 23361474
  13. SFRS10 is not expressed in normal human retinae but is upregulated in Age-related macular degeneration retinae. PMID: 24098751
  14. Specific induction of hTra2beta1 due to Alternative splicing is associated with epithelial ovarian cancer. PMID: 23748175
  15. analysis of mechanisms by which the subcellular and subnuclear localization of Tra2beta proteins are regulated PMID: 23396973
  16. findings show the inclusion of both HIV-1 exon 3 and vpr mRNA processing is promoted by an exonic splicing enhancer (ESEvpr) localized between exonic splicing silencer ESSV and 5'ss D3; the ESEvpr sequence was found to be bound by members of the Tra2 protein family PMID: 23255807
  17. reduced expression of SFRS10, as observed in tissues from obese humans, alters LPIN1 splicing, induces lipogenesis, and therefore contributes to metabolic phenotypes associated with obesity. PMID: 21803291
  18. nuclear hnRNP G level as well as hTra2-beta1 level were independent prognostic factors for endometrial cancer progression-free survival PMID: 20607830
  19. Results indicates that the Human Transformer2-beta RNA recognition motif recognizes two types of RNA sequences in different RNA binding modes. PMID: 20926394
  20. DARPP-32 changes the usage of tra2-beta1 dependent alternative exons in a concentration-dependent manner, suggesting that the DARPP-32:tra2-beta1 interaction is a molecular link between signaling pathways and pre-mRNA processing. PMID: 20074680
  21. interacts with calcitonin/CGRP exon 4 exonic splice enhancer; required for calcitonin splicing in vitro PMID: 12531473
  22. results implicate the human tau gene as a target gene for the alternative splicing regulator Tra2 beta protein, suggesting that Tra2 beta may play a role in aberrant tau exon 10 alternative splicing PMID: 12649279
  23. Tra2beta1 transcript levels are developmentally regulated in a tissue- and temporal-specific pattern, although expression is ubiquitous. PMID: 12798777
  24. Reduced SMN protein levels cause a reduction in the amount of its interacting proteins and of Htra2-beta1 in both discordant and non-discordant spinal muscular atrophy phenotypes. PMID: 14520560
  25. hTra2-beta1 expression in cervical cancer. The observed shuttle process of this splicing factor with higher concentrations in the nucleus effects on the cellular function and tumor biology, leading to the worse patient outcome. PMID: 19037821

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Splicing factor SR family
Tissue Specificity
Highest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver.
Database Links

HGNC: 10781

OMIM: 602719

KEGG: hsa:6434

STRING: 9606.ENSP00000416959

UniGene: Hs.533122

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*