Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

Code CSB-EP025074HU
Abbreviation Recombinant Human TRPA1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
TRPA1
Uniprot No.
Research Area
Neuroscience
Alternative Names
ANKTM 1; ANKTM1; Ankyrin-like with transmembrane domains protein 1; Transformation sensitive protein p120; Transformation-sensitive protein p120; Transient receptor potential cation channel subfamily A member 1; TRPA 1; Trpa1; TRPA1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
957-1119aa
Target Protein Sequence
IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) from mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system.
Gene References into Functions
  1. these results identify a novel AKAP-mediated biochemical mechanism that increases TRPA1 sensitivity in peripheral sensory neurons, and likely contributes to persistent mechanical hypersensitivity. PMID: 28500286
  2. Our findings demonstrate that TRPA1 is a substrate of Cdk5 and that Cdk5 activity is also able to modulate TRPA1 agonist-induced calcium influx and chemo-nociceptive behavioral responses. PMID: 29352128
  3. TRPA1 Modulating C14 Polyacetylenes from the Iranian Endemic Plant Echinophora platyloba. PMID: 30018233
  4. LPS caused the increased functional expression of TRPA1, the activation of which involved in LPS-reduced inflammatory responses in primary human OA-FLS, and the inhibition of TRPA1 produces protective effect in LPS-induced arthritis. PMID: 29318481
  5. Blocking prolyl hydroxylation reveals TRPA1 sensitization to reactive oxygen species (ROS), which enables TRPA1 to convert ROS signalling into cold sensitivity. PMID: 27628562
  6. Data indicate a variant in the transient receptor potential ankyrin A1 channel (TRPA1) gene that selectively cosegregated with cramp-fasciculation syndrome (CFS) in a father-son pair. PMID: 28436534
  7. Peripheral neuronal equivalents (PNEs) exhibited morphological, molecular and functional characteristics of sensory neurons and expressed functional TRPA1 channels. PNE treatment with poly I:C caused similar transient heightened responses to TRPA1 activation compared to untreated cells. PMID: 28931666
  8. These findings provide novel insights into the structure-function relationship of TRPA1 and could lead to the development of more effective analgesics targeted to TRPA1. PMID: 27874100
  9. TRPA1 is involved in nitric oxide-mediated afferent sensory transmission in the clitoris while, in penile erectile tissue, a role for TRPA1 in cholinergic signaling might be assumed. PMID: 28469181
  10. data suggest that the most strictly conserved N-terminal ARs define the energetics of the TRPA1 channel gate and contribute to chemical-, calcium- and voltage-dependence. PMID: 27345869
  11. the heat sensing property of TRPA1 is conserved in mammalians, in which TRPA1 may contribute to sensing warmth and uncomfortable heat in addition to noxious cold. PMID: 27349477
  12. Systemic desensitization through TRPA1 channels by capsazepine and mustard oil - a novel strategy against inflammation and pain. PMID: 27356469
  13. This study reveals a direct binding event and characterizes the role of TRPA1 ankyrin repeats in regulating FGFR2-driven oncogenic process; a mechanism that is hindered by miRNA-142-3p PMID: 29038531
  14. The results obtained with dorsal root ganglia neurons from transient receptor potential cation channel, subfamily A, member 1 channels (TRPA1)-/- mice, TRPM8-/- mice, and wild-type mice, using selective antagonists of TRPA1 and TRPM8 channels, as well as HEK293 cells stably expressing human, TRPA1, indicate that responses to cold, are mediated by TRPA1 channels. PMID: 28408328
  15. TRPA1 gene polymorphisms is associated with childhood asthma PMID: 27779810
  16. TRPM8, but not TRPA1, was detected in freshly isolated native human odontoblasts at the protein and mRNA levels, suggesting that odontoblasts play an important role in detecting external cold stimulation via TRPM8 in healthy condition. PMID: 28043013
  17. neuronal effects of vinca alkaloids require the transient receptor potential ankyrin-1 (TrpA1) channel, and the hypersensitization to painful stimuli in response to the acute exposure to vinca alkaloids is reduced in TrpA1 mutant flies and mice. These findings demonstrate the direct excitation of sensory neurons by CIPN-causing chemotherapy drugs, and identify TrpA1 as an important target during the pathogenesis of CIPN PMID: 29084244
  18. The TRPA1 cation channel was found to be functionally expressed in primary human osteoarthritis chondrocytes, which is an original finding PMID: 27515912
  19. The findings of this study support the notion that epigenetic regulation of TRPA1 seems to regulate thermal and mechanical pain sensitivities. PMID: 28030472
  20. We provided evidence for the extraneuronal presence and upregulation of the proinflammatory TRPA1 receptor in buccal samples of patients with OLP. This may implicate the ion channel in the pathomechanism of OLP. PMID: 27718297
  21. TRPA1 DNA methylation in whole blood cells are associated with pain symptoms in chronic pain patients. PMID: 26849948
  22. Here we highlight the role of TRPA1 as a multipurpose sensor of harmful signals and as a sensor of stress and tissue damage. PMID: 27079970
  23. Three negatively charged amino acids near the outer pore vestibule are involved in heat-evoked TRPA1 activation in the presence of extracellular calcium. PMID: 28194754
  24. These results suggest that IL-1alpha enhances the translocation of TRPA1 to the plasma membrane via the activation of Erk in A549. PMID: 28629997
  25. Respiratory syncytial virus and measles virus infection upregulates TRPA1 expression in bronchial epithelial cells. PMID: 28187208
  26. Protein kinase A is an important kinase acting downstream of inflammatory mediators to cause sensitization of TRPA1. PMID: 28076424
  27. TRPA1 channels are involved in regulating the extent of airway inflammation driven by cystic fibrosis bronchial epithelial cells. PMID: 27281024
  28. The aspartate residue at position 915 represents a constriction site of the TRPA1 pore. PMID: 27824920
  29. data suggest that cardamonin is a selective TRPA1 antagonist, providing novel insight into the target of its anti-nociceptive activity. PMID: 27589700
  30. TRPA1 activation stimulates a cholinergic mechanism in a tetrodotoxin-resistant manner to cause muscle contraction. PMID: 26928772
  31. Taken together, these data demonstrated that TRPA1 activation played an important role in the enhanced production of reactive oxygen species induced by cold stress in A549 cell. PMID: 26634370
  32. Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain. PMID: 26046936
  33. TRPA1 was expressed in all studied regions (tongue, epiglottis, and pharynx), but was always localized below the basal lamina. No immunoreactivity for TRPA1 was found on epithelial cells. PMID: 26530852
  34. exposure to cigarette smoke extract initially causes an increase in the extracellular level of ROS, which in turn activates lung epithelial TRPA1 PMID: 26504357
  35. Certain TRPA1 variants and tyrosine-to-phenylalanine mutants exhibited good function compared with non-mutated TRPA1 in transfected HEK293 cells PMID: 26330615
  36. the inflammatory cytokine TNF-a can modulate the activity of the mechanosensitive ion channels TRPA1 and TRPV4 in odontoblasts via the p38 MAPK pathway but has differential effects on their expression. PMID: 26358221
  37. TRPA1 activity may modulate asthma, particularly among individuals living in locations prone to high levels of air pollution. PMID: 26039217
  38. The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives PMID: 25765567
  39. Authors propose that inter-subunit salt bridges between adjacent S4-S5 regions are crucial for stabilizing the conformations associated with chemically and voltage-induced gating of the TRPA1 ion channel. PMID: 25724085
  40. It appears that TRPA1 channels may be determinants of airway smooth muscle (ASM) contractility and local inflammation control, positioning them as part of novel mechanisms that control (patho)physiological function of airways and ASM. [Review] PMID: 25654580
  41. Hypothermia mediates its effects on monocytes through TRPA1. PMID: 26054320
  42. The TRPA1 promoter was hypermethylated in individuals with lower pain thresholds, and promoter DNA methylation can downregulate gene expression. PMID: 24496475
  43. carnosol is a new anti-nociceptive agent targeting TRPA1 that can be used to explore further biological role in pain therapy. PMID: 25405290
  44. TRPA1 mrna was increased in the epidermis of itching burn scar patients. PMID: 24695993
  45. Peptide derived from C-terminus of human TRPA1 channel has a strong interaction and affinity with membranes containing anionic lipids. PMID: 25687973
  46. findings indicate that transient receptor potential cationic channel type A1 might be involved in afferent neurotransmission in the vagina and work synergistically together with the nitric oxide/cyclic guanosine monophosphate pathway. PMID: 25056810
  47. Localized TRPA1 channel Ca2+ signals stimulated by reactive oxygen species promote cerebral artery dilation. PMID: 25564678
  48. TRPM8 and TRPA1 assays were inhibited by probenecid. PMID: 24975826
  49. TRPA1 is a major mediator of the proinflammatory/proalgesic actions of aromatase inhibitors PMID: 25484020
  50. TRPA1 is upregulated in colitis and its activation exerts protective roles by decreasing the expressions of several proinflammatory neuropeptides, cytokines and chemokines PMID: 25265225

Show More

Hide All

Involvement in disease
Episodic pain syndrome, familial, 1 (FEPS1)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family
Tissue Specificity
Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.
Database Links

HGNC: 497

OMIM: 604775

KEGG: hsa:8989

STRING: 9606.ENSP00000262209

UniGene: Hs.716816

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*