CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-YP023924HU |
Size | US$1593 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant active human Transmembrane protease serine 2 (TMPRSS2) is produced by the expression of a target DNA sequence with 6xHis, N-terminal tag(s), in the yeast expression system. The target DNA sequence encodes the 106-492aa region of the human TMPRSS2. The purity of this partial-length protein is greater than 85% determined by SDS-PAGE. The gel showed a molecular weight band of about 45 kDa under reducing conditions. And its enzymatic activity was verified by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) (Km is 21.93μM). The protease TMPRSS2 plays an important role in the infection mechanism of human coronaviruses, such as SARS-CoV and SARS-CoV-2. Cell entry of human coronaviruses depends on the binding of the viral spike (S) glycoprotein to cellular ACE2 receptor and S protein priming by host cell protease TMPRSS2. Moreover, TMPRSS2 protein is commonly used to study cancer. Previous studies have shown that the TMPRSS2 gene was up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Activity | Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. |
Target Names | TMPRSS2 |
Uniprot No. | O15393 |
Research Area | Cancer |
Alternative Names | (Serine protease 10) (PRSS10) |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 106-492 aa |
Target Protein Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Mol. Weight | 44.8kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Tris-based buffer,50% glycerol |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Applications : Enzymatic activity in vitro
Review: CSB-YP023924HU- TMPRSS2 - Lot DA04630a6g0 works so we will ordering the remaining 950ug of the same lot.
By Anonymous
Applications : Enzymatic activity in vitro
Review: We tested the protein and is having positive preliminary results.
By Anonymous
Applications : Enzymatic activity in vitro
Review: The enzyme demonstrates good relative activity in our preliminary testing, and should allow us to complete our first round of proposed screening. Once completed, that screening data will be posted on our Open Data Portal (https://opendata.ncats.nih.gov/covid19/), which will include assay details and list you as the source of the enzyme, which I trust will be welcomed by your sales team. To support further screening, we would like to order more, and kindly ask for a new quote for 5mgs, along with an estimated timeline, if possible.
By Anonymous
Applications : Enzymatic activity in vitro
Review: Can you let me know the availability of catalog: CSB-YP023924HU? We would be interested in ordering either 1 or 2 x 100ug or 1mg. Can you let me know if lot DA04585a6g0 is available to fulfill those orders? We previously received this lot in early August which shows good activity and would like to receive this lot again if it is available.
By Anonymous
We will require this recombinant TMPRSS2 protein to set up the assays and to screen the chemical library. So, please suggest which one I should choose, Yeast derived or E coli derived?
What QC test will you perform?
What is the general protectant? What kind of protectant do you usually add?
When making TMPRSS2, do you use any protein denaturing purification steps?
Is TMPRSS2 soluble in water (buffer) or is it necessary to resuspend products in a solvent such as DMSO?
Was it difficult to manufacture TMPRSS2?
Do you know whether this product has been tested for activity?
I want to order 500 μg of CSB-YP023924HU. Would you let me know what form of the protein is provided (liquid or powder)?
Can you remove the endotoxin?
What is the general preservative? Which kind of preservative do you usually add?
Function | Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity. |
Gene References into Functions |
|
Subcellular Location | Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Transmembrane protease serine 2 catalytic chain: Secreted |
Protein Families | Peptidase S1 family |
Tissue Specificity | Highly expressed in prostate epithelial cells and in prostate cancers. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland. |
Database Links |
HGNC: 11876 OMIM: 602060 KEGG: hsa:7113 STRING: 9606.ENSP00000381588 UniGene: Hs.439309 |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide