Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)
Brand: CUSABIO
SKU: CSB-YP023924HU
Price: $306 USD
Availability: InStock
Rating: 5.0 (9 reviews)

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

①Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. ②Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM.

Target Names

TMPRSS2

Uniprot No.

O15393

Research Area

Cancer

Alternative Names

TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

106-492 aa

Target Protein Sequence

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Mol. Weight

44.8kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TMPRSS2 is a type II transmembrane serine protease critically implicated in viral entry and oncogenic signaling, making robust enzymatic preparations essential for mechanistic and therapeutic research. This recombinant human TMPRSS2 partial construct (106–492 aa) carries an N-terminal 6×His tag positioned away from the catalytic domain, preserving active-site accessibility for accurate kinetic measurements — validated by cleavage of the fluorogenic substrate Boc-Gln-Ala-Arg-AMC with a Km of 21.93 μM and confirmed sensitivity to Camostat Mesylate inhibition (EC50 of 0.033–0.079 μM). These quantitative benchmarks provide a suitable basis for inhibitor screening and IC50 determination, substrate specificity profiling, Km/Vmax/kcat kinetic parameter analysis, and drug candidate evaluation targeting TMPRSS2-dependent pathways in cancer biology. Expressed in yeast and purified to greater than 85% by SDS-PAGE, this preparation meets the quality thresholds commonly required for use as a positive control in enzyme-linked assays and for generating reproducible dose-response curves.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 9 reviews

Submit a Review here

Applications : Enzymatic activity in vitro

Review: CSB-YP023924HU- TMPRSS2 - Lot DA04630a6g0 works so we will ordering the remaining 950ug of the same lot.

By Anonymous

Applications : Enzymatic activity in vitro

Review: We tested the protein and is having positive preliminary results.

By Anonymous

Applications : Enzymatic activity in vitro

Review: The enzyme demonstrates good relative activity in our preliminary testing, and should allow us to complete our first round of proposed screening. Once completed, that screening data will be posted on our Open Data Portal (https://opendata.ncats.nih.gov/covid19/), which will include assay details and list you as the source of the enzyme, which I trust will be welcomed by your sales team. To support further screening, we would like to order more, and kindly ask for a new quote for 5mgs, along with an estimated timeline, if possible.

By Anonymous

Applications : Enzymatic activity in vitro

Review: Can you let me know the availability of catalog: CSB-YP023924HU? We would be interested in ordering either 1 or 2 x 100ug or 1mg. Can you let me know if lot DA04585a6g0 is available to fulfill those orders? We previously received this lot in early August which shows good activity and would like to receive this lot again if it is available.

By Anonymous

Applications : Surface plasmon resonance (SPR)

Review: TMPRSS2 using pERTKR-AMC or Boc-QAR-AMC respectively. 100 µM of compound, or vehicle control (DMSO), was incubated with the proteases for 30 minutes prior to addition of substrate and detection of fluorescent activity.

By Anonymous

Applications : antiviral potential of atovaquone

Review: Atovaquone restricts wtVSV and VSV-SARS spike infectivity in VeroE6 and VeroE6 hTMPRSS2-hACE2 cells. VeroE6 cells or VeroE6 cells stably transduced with hACE2 and TMPRSS2 were seeded at 2.5 × 104 cells/cm2 in 96-well plates and treated with various concentrations of atovaquone.

By Anonymous

Applications : Western blot

Review: TMPRSS2-mediated S-protein cleavage in the presence or absence of individual serpins and the known protease inhibitor nafamostat mesylate. Data from three independent experiments were quantified, and a representative blot is shown (E). The intensity of bands in panel E corresponding to cleaved S-protein was quantified using ImageJ (Fuji) and normalized to S-protein and TMPRSS2 control. Mean values and SEM are shown; statistical significance was calculated by unpaired t test (*, P , 0.05; **, P , 0.01) (F).

By Anonymous

Applications : luciferase activity assay

Review: Infectivity of PsVs with different point mutations in CS-1 and CS-2 was assessed in 293 T/ACE2 cells with CTSL (293 T/CTSL), TMPRSS2 (293 T/TMPRSS2), and FURIN (293 T/FURIN) genes overexpression. PsV infectivity was measured by a luciferase assay and is shown as the raw luciferase activity (n = 3–4). Infectivity of PsVs at the indicated fold dilutions in in LLC-MK2, Vero, Huh7, 293T/ACE2 cells and in 293T/ACE2 cells with CTSL (293T/CTSL), TMPRSS2 (293T/TMPRSS2) and FURIN (293T/FURIN) genes overexpression. (n = 4).

By Anonymous

Applications : Drug related studies

Review: The compounds against 30 nM of human TMPRSS2 using fluorogenic substrate 100 µM Boc-Gln-Ala-Arg-AMC; however, there was no inhibitory activity of any compound up to 100 μM against serine protease TMPRSS2.

By Anonymous

Read more reviews >>

■ Q&A

We will require this recombinant TMPRSS2 protein to set up the assays and to screen the chemical library. So, please suggest which one I should choose, Yeast derived or E coli derived?

TMPRSS2 protein exists post-translationally modified, but the prokaryotic system is lack of post-translational modification, so we recommend you to choose eukaryotic system, such as Yeast and Mammalian cell expression systems.

What QC test will you perform?

Quality Control:
1. Cloning Stage: Sequencing of the expression plasmid to ensure that the gene is completely correct. (Free of Charge. It is our routine detection.)
2. Protein Stage:
2.1. SDS-PAGE detection to determine purity and molecular weight (determine whether the observed value and the theoretical value are consistent). We comprehensively evaluate the purity through SDS-PAGE Coomassie brilliant blue staining detection and analysis using Bandscan software to ensure that the purity is more than 90%. (Free of Charge. It is our routine detection.)
2.2. Each batch will be tested for activity before shipped. (Free of Charge. It is our routine detection.)
2.3. WB detection (It is generally WB detection of tag-antibody, if there is a corresponding specific antibody, it will be arranged) to further determine the molecular weight of the protein (determine whether the observed value and the theoretical value are consistent) and its specificity. (Free of Charge. It will be performed upon customers' requests.)
2.4. AKTA-SEC test: For customers who need it, it can be used as a molecular sieve for further purification, while determining the purity and morphology of the protein (judging the presence of multimers). (Paid Service. It will be performed upon customers' requests.)
2.5. MS Identification: For customers who need it, we can arrange for mass spectrometry identification a separate sample. (Paid Service. It will be performed upon customers' requests.)
2.6. MS Identification: There is also a free monthly mass spectrometry identification (mixed samples will be detected). (Free of Charge. It is our routine detection.)

What is the general protectant? What kind of protectant do you usually add?

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

When making TMPRSS2, do you use any protein denaturing purification steps?

No, we don't use any protein denaturing purification steps. The protein is purified under mild conditions to avoid denaturation of the protein and to preserve the protein's natural state to the maximum.

Is TMPRSS2 soluble in water (buffer) or is it necessary to resuspend products in a solvent such as DMSO?

It's soluble in Tris-buffer.

Was it difficult to manufacture TMPRSS2?

The expression of TMPRSS2 is not difficult. We've expressed it successfully and have stable stock of it.

Do you know whether this product has been tested for activity?

We're conducting activity testing for this protein. The activity data will be uploaded once the testing is finished.

I want to order 500 μg of CSB-YP023924HU. Would you let me know what form of the protein is provided (liquid or powder)?

The default shipping form is lyophilized powder. If you want liquid form, we can also meet, please note when ordering.

Can you remove the endotoxin?

Yes. We can provide endotoxin removal service free of charge and guarantee the endotoxin level to be less than 0.1ng/μg (1EU μg).

What is the general preservative? Which kind of preservative do you usually add?

Commonly used preservative include Proclin 300, Sodium azide, etc. We do not add any preservative to our protein.

Target Background

Function

Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the protease activated receptor-2/F2RL1 or matriptase/ST14 leading to extracellular matrix disruption and metastasis of prostate cancer cells. In addition, activates trigeminal neurons and contribute to both spontaneous pain and mechanical allodynia.; (Microbial infection) Facilitates human coronaviruses SARS-CoV and SARS-CoV-2 infections via two independent mechanisms, proteolytic cleavage of ACE2 receptor which promotes viral uptake, and cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry. Upon SARS-CoV-2 infection, increases syncytia formation by accelerating the fusion process. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.

Gene References into Functions

A potential novel function of TMPRSS2-ERG as a major regulator of IGF1R gene expression. PMID: 27285981
Study shows that T2E fusion transcripts are associated with higher levels of AMACR mRNA in patients with atypical small acinar proliferation (ASAP) which represents an indicator of risk for prostate cancer in patients with ASAP. PMID: 29277318
TMPRSS2-ERG may have a role in progression of prostate neoplasms and in alteration of the metabolic profile PMID: 27276682
We propose that epigenetic events are a significant and alternative driver of aggressive disease in TMPRSS2-ERG fusion-negative prostate cancer. PMID: 27814612
Meta-analysis showed the prevalence of TMPRSS2:ERG fusions in prostate cancer to be highest in men of European descent (49%), followed by Asians (27%) and then African (25%) descent. PMID: 28633309
Data show that tumors displaying TMPRSS2-ERG fusions that retained interstitial genes were less likely to be associated with biochemical recurrence PMID: 29127096
We demonstrate a role for inflammation-induced oxidative stress in the formation of DNA breaks leading to recurrent TMPRSS2-ERG gene fusions. The transcriptional status and epigenetic features of the target genes influence this effect. PMID: 27926866
NOTCH pathway inhibition antagonizes the growth and invasion of transmembrane protease serine 2 (TMPRSS2)-transforming protein ERG (ERG) (T2E) -positive prostate cancer cells. PMID: 28783165
The TMPRSS2-ERG gene fusion is the most frequently observed genetic aberration in prostate cancer. PMID: 28845585
Study provide evidence that PTEN deletion and TMPRSS2-ERG gene fusion were mutually exclusive in patients with prostate neoplasm. TMPRSS2-ERG gene fusion was rare compared to peripheral zone tumors and to PTEN inactivation in T1a transition zone tumors. PMID: 27500376
miR-204 upregulates androgen receptor (AR ) and downregulates TMPRSS2/ERG through direct regulation of their promoter methylation and set of transcription factors during AR cancer-related reprogramming. PMID: 28050800
differential expression of TMPRSS2:ERG in urine exosomes in prostate cancer and controls PMID: 27144529
The present study established evidence for the first two common PrCa risk variants differentially associated with TMPRSS2:ERG fusion status. TMPRSS2:ERG phenotyping of larger studies is required to determine comprehensive sets of variants with subtype-specific roles in prostate cancer. PMID: 27798103
Human coronavirus 229E presumably evolved to bypass the endosome by entering the cell via TMPRSS2. PMID: 27733646
Studies indicate that TMPRSS2-ERG fusion gene positive prostate cancers cells rewire intracellular signaling cascades and modulate gene and protein network. PMID: 28364793
TMPRSS2-ERG role in prostate cancer invasiveness and regulation of MMP-9 and plexin B1. PMID: 28004109
Our results indicate that it is possible to predict pT3 stage at final histology from TMPRSS2:ERG gene fusion at initial core needle biopsy. FISH determination of TMPRSS2:ERG gene fusion may be particularly useful for patients scheduled to undergo a radical prostatectomy in order to improve oncological and functional results PMID: 27377958
Data show there was a good agreement of transcriptional regulator ERG protein (ERG) immunostaining with the presence of TMPRSS2:ERG fusion protein. PMID: 27320318
A combination of high preoperative serum PSA and high expression of TMPRSS2-ERG could be promising in distinguishing those tumors that are aggressive and life-threatening. PMID: 27630329
Studies showed that urinary TMPRSS2:ERG transcripts seem to be indicative of Prostate cancer aggressiveness upon biopsy. [review] PMID: 26774207
Aspirin was associated with a significant reduction in the relative risk of TMPRSS2:ERG (T2E )fusion positive, but not T2E negative PMID: 26503111
the type II transmembrane serine protease TMPRSS2 was able to activate hemagglutinin for cell entry indicating that bat influenza A virus can utilize human proteases for hemagglutinin activation. PMID: 27028521
The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia PMID: 26978019
TMPRSS2 isoform 1 is expressed in viral target cells. PMID: 26379044
The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition PMID: 26026052
The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer. PMID: 26615022
Results indicate that PTEN loss occurs in cooperation with TMPRSS2-ERG fusion in prostate cancer and the majority of the samples harbor TMPRSS2-ERG fusion as well as PTEN gene deletion. PMID: 26424596
Elucidation of ERG regulation of ABEs in castration-resistant prostate cancer (CRPC) may help to stratify TMPRSS2-ERG fusion-positive prostate cancer patients in the clinic for anti-androgen receptor-driven therapies. PMID: 25754347
these data show that the androgen-driven events causing TMPRSS2-ERG fusions and other rearrangements of androgen-dependent genes in prostate epithelial cells of young patients preferentially lead to low-grade (and not high-grade) prostate cancer. PMID: 25015038
TMPRSS2-ERG fusion gene transcript was found in 63, 55 and 73% of the prostate cancer cases on urine alone, biopsy rinse material alone and paired samples, respectively. PMID: 24997128
Genetic inhibition of TMPRSS2-ERG junction oncogene in prostate cancer by means of siRNA has strong antineoplastic effect in a mouse model and in vitro. PMID: 25933120
Data showed that TMPRSS2 expression is not only dramatically increased in the primary cancers of patients but TMPRSS2 immunopositivity is also directly correlated with cancer pain severity in these patients. PMID: 25734995
High AR gene copy number emerges during the development of Small cell carcinoma of the prostate, often in association with TMPRSS2-ERG rearrangement. PMID: 24777847
Both IHC and qRT-PCR are useful tools in detecting TMPRSS2:ERG fusions. PMID: 25007891
Membrane bound meprin Beta is activated by transmembrane serine protease matriptase-2 at the cell surface. PMID: 26251449
Data indicate that inhibition of transcriptional regulator ERG protein expression in transmembrane protease serine 2 protein (TMPRSS2):ERG-positive prostate cancer cells increased neuroendocrine cell gene expression. PMID: 25263440
TMPRSS2 promotes the growth, invasion, and metastasis of prostate cancer cells via matriptase activation and extracellular matrix disruption. PMID: 26018085
Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement. PMID: 25977336
The TMPRSS2 Met160Val polymorphism is a genetic risk factor for sporadic prostate cancer in a Japanese population. PMID: 25040002
The expression levels of the TMPRSS2-ERG fusion is related to a more aggressive phenotype, have an effect on prognosis and could be molecular markers of progression for prostate cancer. PMID: 25939480
Results provide suggestive evidence that men with TMPRSS2:ERG positive tumors may have longer prostate cancer survival after ADT. PMID: 25728532
recent and maximum BMI are inversely associated with the odds of developing T2E-positive prostate cancer, but no associations were observed for T2E-negative prostate canc PMID: 25852077
TMPRSS2-ERG gene fusions induce prostate tumorigenesis by modulating microRNA miR-200c. PMID: 24186205
activates hepatitis C virus infection at the postbinding and entry stage PMID: 25203900
results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus PMID: 25175909
The effect of TMPRSS2/ERG gene fusions had differing effects on radiosensitivity and chemosensitivity depending on cell line and fusion type. PMID: 21394739
These findings indicate that TMPRSS2-ERG may or may not lead to prostate cancer development PMID: 24961351
Report prognostic value of tissue/urinary TMPRSS2-ERG levels in prostate neoplasms. PMID: 24072184
concurrent in situ detection of gene expression, point mutations, and gene fusions of the prostate cancer relevant targets TMPRSS2-ERG PMID: 24931216
TMPRSS2:ERG gene fusion synergizes with the VDR to induce CYP24A1 expression-limiting VDR signaling. PMID: 24926821

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Transmembrane protease serine 2 catalytic chain]: Secreted.

Protein Families

Peptidase S1 family

Tissue Specificity

Expressed in several tissues that comprise large populations of epithelial cells with the highest level of transcripts measured in the prostate gland. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine.

Database Links

HGNC: 11876

OMIM: 602060

KEGG: hsa:7113

STRING: 9606.ENSP00000381588

UniGene: Hs.439309

Code	CSB-YP023924HU
Abbreviation	Recombinant Human TMPRSS2 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. Biological Activity Assay Activity Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC₅₀ is 0.03347-0.07945μM. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage