Name: Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial,Biotinylated
Brand: CUSABIO
SKU: CSB-EP023924HU-B

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	TMPRSS2
Uniprot No.	O15393
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	106-492aa
Target Protein Sequence	WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	90.6 kDa
Protein Length	Partial
Tag Info	N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function	Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.
Gene References into Functions	A potential novel function of TMPRSS2-ERG as a major regulator of IGF1R gene expression. PMID: 27285981 Study shows that T2E fusion transcripts are associated with higher levels of AMACR mRNA in patients with atypical small acinar proliferation (ASAP) which represents an indicator of risk for prostate cancer in patients with ASAP. PMID: 29277318 TMPRSS2-ERG may have a role in progression of prostate neoplasms and in alteration of the metabolic profile PMID: 27276682 We propose that epigenetic events are a significant and alternative driver of aggressive disease in TMPRSS2-ERG fusion-negative prostate cancer. PMID: 27814612 Meta-analysis showed the prevalence of TMPRSS2:ERG fusions in prostate cancer to be highest in men of European descent (49%), followed by Asians (27%) and then African (25%) descent. PMID: 28633309 Data show that tumors displaying TMPRSS2-ERG fusions that retained interstitial genes were less likely to be associated with biochemical recurrence PMID: 29127096 We demonstrate a role for inflammation-induced oxidative stress in the formation of DNA breaks leading to recurrent TMPRSS2-ERG gene fusions. The transcriptional status and epigenetic features of the target genes influence this effect. PMID: 27926866 NOTCH pathway inhibition antagonizes the growth and invasion of transmembrane protease serine 2 (TMPRSS2)-transforming protein ERG (ERG) (T2E) -positive prostate cancer cells. PMID: 28783165 The TMPRSS2-ERG gene fusion is the most frequently observed genetic aberration in prostate cancer. PMID: 28845585 Study provide evidence that PTEN deletion and TMPRSS2-ERG gene fusion were mutually exclusive in patients with prostate neoplasm. TMPRSS2-ERG gene fusion was rare compared to peripheral zone tumors and to PTEN inactivation in T1a transition zone tumors. PMID: 27500376 miR-204 upregulates androgen receptor (AR ) and downregulates TMPRSS2/ERG through direct regulation of their promoter methylation and set of transcription factors during AR cancer-related reprogramming. PMID: 28050800 differential expression of TMPRSS2:ERG in urine exosomes in prostate cancer and controls PMID: 27144529 The present study established evidence for the first two common PrCa risk variants differentially associated with TMPRSS2:ERG fusion status. TMPRSS2:ERG phenotyping of larger studies is required to determine comprehensive sets of variants with subtype-specific roles in prostate cancer. PMID: 27798103 Human coronavirus 229E presumably evolved to bypass the endosome by entering the cell via TMPRSS2. PMID: 27733646 Studies indicate that TMPRSS2-ERG fusion gene positive prostate cancers cells rewire intracellular signaling cascades and modulate gene and protein network. PMID: 28364793 TMPRSS2-ERG role in prostate cancer invasiveness and regulation of MMP-9 and plexin B1. PMID: 28004109 Our results indicate that it is possible to predict pT3 stage at final histology from TMPRSS2:ERG gene fusion at initial core needle biopsy. FISH determination of TMPRSS2:ERG gene fusion may be particularly useful for patients scheduled to undergo a radical prostatectomy in order to improve oncological and functional results PMID: 27377958 Data show there was a good agreement of transcriptional regulator ERG protein (ERG) immunostaining with the presence of TMPRSS2:ERG fusion protein. PMID: 27320318 A combination of high preoperative serum PSA and high expression of TMPRSS2-ERG could be promising in distinguishing those tumors that are aggressive and life-threatening. PMID: 27630329 Studies showed that urinary TMPRSS2:ERG transcripts seem to be indicative of Prostate cancer aggressiveness upon biopsy. [review] PMID: 26774207 Aspirin was associated with a significant reduction in the relative risk of TMPRSS2:ERG (T2E )fusion positive, but not T2E negative PMID: 26503111 the type II transmembrane serine protease TMPRSS2 was able to activate hemagglutinin for cell entry indicating that bat influenza A virus can utilize human proteases for hemagglutinin activation. PMID: 27028521 The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia PMID: 26978019 TMPRSS2 isoform 1 is expressed in viral target cells. PMID: 26379044 The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition PMID: 26026052 The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer. PMID: 26615022 Results indicate that PTEN loss occurs in cooperation with TMPRSS2-ERG fusion in prostate cancer and the majority of the samples harbor TMPRSS2-ERG fusion as well as PTEN gene deletion. PMID: 26424596 Elucidation of ERG regulation of ABEs in castration-resistant prostate cancer (CRPC) may help to stratify TMPRSS2-ERG fusion-positive prostate cancer patients in the clinic for anti-androgen receptor-driven therapies. PMID: 25754347 these data show that the androgen-driven events causing TMPRSS2-ERG fusions and other rearrangements of androgen-dependent genes in prostate epithelial cells of young patients preferentially lead to low-grade (and not high-grade) prostate cancer. PMID: 25015038 TMPRSS2-ERG fusion gene transcript was found in 63, 55 and 73% of the prostate cancer cases on urine alone, biopsy rinse material alone and paired samples, respectively. PMID: 24997128 Genetic inhibition of TMPRSS2-ERG junction oncogene in prostate cancer by means of siRNA has strong antineoplastic effect in a mouse model and in vitro. PMID: 25933120 Data showed that TMPRSS2 expression is not only dramatically increased in the primary cancers of patients but TMPRSS2 immunopositivity is also directly correlated with cancer pain severity in these patients. PMID: 25734995 High AR gene copy number emerges during the development of Small cell carcinoma of the prostate, often in association with TMPRSS2-ERG rearrangement. PMID: 24777847 Both IHC and qRT-PCR are useful tools in detecting TMPRSS2:ERG fusions. PMID: 25007891 Membrane bound meprin Beta is activated by transmembrane serine protease matriptase-2 at the cell surface. PMID: 26251449 Data indicate that inhibition of transcriptional regulator ERG protein expression in transmembrane protease serine 2 protein (TMPRSS2):ERG-positive prostate cancer cells increased neuroendocrine cell gene expression. PMID: 25263440 TMPRSS2 promotes the growth, invasion, and metastasis of prostate cancer cells via matriptase activation and extracellular matrix disruption. PMID: 26018085 Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement. PMID: 25977336 The TMPRSS2 Met160Val polymorphism is a genetic risk factor for sporadic prostate cancer in a Japanese population. PMID: 25040002 The expression levels of the TMPRSS2-ERG fusion is related to a more aggressive phenotype, have an effect on prognosis and could be molecular markers of progression for prostate cancer. PMID: 25939480 Results provide suggestive evidence that men with TMPRSS2:ERG positive tumors may have longer prostate cancer survival after ADT. PMID: 25728532 recent and maximum BMI are inversely associated with the odds of developing T2E-positive prostate cancer, but no associations were observed for T2E-negative prostate canc PMID: 25852077 TMPRSS2-ERG gene fusions induce prostate tumorigenesis by modulating microRNA miR-200c. PMID: 24186205 activates hepatitis C virus infection at the postbinding and entry stage PMID: 25203900 results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus PMID: 25175909 The effect of TMPRSS2/ERG gene fusions had differing effects on radiosensitivity and chemosensitivity depending on cell line and fusion type. PMID: 21394739 These findings indicate that TMPRSS2-ERG may or may not lead to prostate cancer development PMID: 24961351 Report prognostic value of tissue/urinary TMPRSS2-ERG levels in prostate neoplasms. PMID: 24072184 concurrent in situ detection of gene expression, point mutations, and gene fusions of the prostate cancer relevant targets TMPRSS2-ERG PMID: 24931216 TMPRSS2:ERG gene fusion synergizes with the VDR to induce CYP24A1 expression-limiting VDR signaling. PMID: 24926821 Show More Hide All
Subcellular Location	Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Transmembrane protease serine 2 catalytic chain: Secreted
Protein Families	Peptidase S1 family
Tissue Specificity	Highly expressed in prostate epithelial cells and in prostate cancers. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland.
Database Links	HGNC: 11876 OMIM: 602060 KEGG: hsa:7113 STRING: 9606.ENSP00000381588 UniGene: Hs.439309

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP023924HU-B
Size
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial,Biotinylated

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage