Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Recombinant Human TMPRSS2 His tag protein (CSB-MP023924HU(M)b0) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 19.16μM. ②Measured by Bromhexine Hydrochloride inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Bromhexine Hydrochloride inhibit EC50 is 81.79-154.2μM. ③Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.005877- 0.01293μM.
Research Area
Biochemicals
Alternative Names
TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10
Species
Homo sapiens (Human)
Expression Region
106-492aa(R255Q)
Target Protein Sequence
WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG-
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human transmembrane protease serine 2 (TMPRSS2) (R255Q) is expressed in the mammalian cells with N-terminally tagged 10xHis motif. Its expression region corresponds to amino acid residues 106-493 of the human TMPRSS2 protein. The purity of this recombinant protein is over 90% determined by the SDS-PAGE. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. Validation of its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) shows this protein is active. It is available now. The target protein TMPRSS2 is a cell surface protein mainly expressed by endothelial cells across the respiratory and digestive tracts. It participates in the cleavage of peptide bonds of proteins that have serine as the nucleophilic amino acid within the active site acts. Emerging evidence has shown that TMPRSS2 acts to activate the SARS-CoV-2 spike (S) protein and facilitate viral entry into host cells.