Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial

Code CSB-EP023924HU
Size US$2062
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names TMPRSS2
Uniprot No. O15393
Research Area Cancer
Alternative Names D16Ertd61e; Epitheliasin; FLJ41954; MGC6821; PP9284; PRSS10; Serine protease 10; TMPRSS2; TMPRSS2 ERG FUSION GENE, INCLUDED; TMPRSS2 ETV1 FUSION GENE, INCLUDED; TMPS2_HUMAN; Transmembrane protease serine 2 catalytic chain; Transmembrane protease, serine 2; Transmembrane protease, serine 2, EC 3.4.219
Species Homo sapiens (Human)
Source E.coli
Expression Region 106-492aa
Target Protein Sequence WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.9 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.
Gene References into Functions
  1. A potential novel function of TMPRSS2-ERG as a major regulator of IGF1R gene expression. PMID: 27285981
  2. Study shows that T2E fusion transcripts are associated with higher levels of AMACR mRNA in patients with atypical small acinar proliferation (ASAP) which represents an indicator of risk for prostate cancer in patients with ASAP. PMID: 29277318
  3. TMPRSS2-ERG may have a role in progression of prostate neoplasms and in alteration of the metabolic profile PMID: 27276682
  4. We propose that epigenetic events are a significant and alternative driver of aggressive disease in TMPRSS2-ERG fusion-negative prostate cancer. PMID: 27814612
  5. Meta-analysis showed the prevalence of TMPRSS2:ERG fusions in prostate cancer to be highest in men of European descent (49%), followed by Asians (27%) and then African (25%) descent. PMID: 28633309
  6. Data show that tumors displaying TMPRSS2-ERG fusions that retained interstitial genes were less likely to be associated with biochemical recurrence PMID: 29127096
  7. We demonstrate a role for inflammation-induced oxidative stress in the formation of DNA breaks leading to recurrent TMPRSS2-ERG gene fusions. The transcriptional status and epigenetic features of the target genes influence this effect. PMID: 27926866
  8. NOTCH pathway inhibition antagonizes the growth and invasion of transmembrane protease serine 2 (TMPRSS2)-transforming protein ERG (ERG) (T2E) -positive prostate cancer cells. PMID: 28783165
  9. The TMPRSS2-ERG gene fusion is the most frequently observed genetic aberration in prostate cancer. PMID: 28845585
  10. Study provide evidence that PTEN deletion and TMPRSS2-ERG gene fusion were mutually exclusive in patients with prostate neoplasm. TMPRSS2-ERG gene fusion was rare compared to peripheral zone tumors and to PTEN inactivation in T1a transition zone tumors. PMID: 27500376
  11. miR-204 upregulates androgen receptor (AR ) and downregulates TMPRSS2/ERG through direct regulation of their promoter methylation and set of transcription factors during AR cancer-related reprogramming. PMID: 28050800
  12. differential expression of TMPRSS2:ERG in urine exosomes in prostate cancer and controls PMID: 27144529
  13. The present study established evidence for the first two common PrCa risk variants differentially associated with TMPRSS2:ERG fusion status. TMPRSS2:ERG phenotyping of larger studies is required to determine comprehensive sets of variants with subtype-specific roles in prostate cancer. PMID: 27798103
  14. Human coronavirus 229E presumably evolved to bypass the endosome by entering the cell via TMPRSS2. PMID: 27733646
  15. Studies indicate that TMPRSS2-ERG fusion gene positive prostate cancers cells rewire intracellular signaling cascades and modulate gene and protein network. PMID: 28364793
  16. TMPRSS2-ERG role in prostate cancer invasiveness and regulation of MMP-9 and plexin B1. PMID: 28004109
  17. Our results indicate that it is possible to predict pT3 stage at final histology from TMPRSS2:ERG gene fusion at initial core needle biopsy. FISH determination of TMPRSS2:ERG gene fusion may be particularly useful for patients scheduled to undergo a radical prostatectomy in order to improve oncological and functional results PMID: 27377958
  18. Data show there was a good agreement of transcriptional regulator ERG protein (ERG) immunostaining with the presence of TMPRSS2:ERG fusion protein. PMID: 27320318
  19. A combination of high preoperative serum PSA and high expression of TMPRSS2-ERG could be promising in distinguishing those tumors that are aggressive and life-threatening. PMID: 27630329
  20. Studies showed that urinary TMPRSS2:ERG transcripts seem to be indicative of Prostate cancer aggressiveness upon biopsy. [review] PMID: 26774207
  21. Aspirin was associated with a significant reduction in the relative risk of TMPRSS2:ERG (T2E )fusion positive, but not T2E negative PMID: 26503111
  22. the type II transmembrane serine protease TMPRSS2 was able to activate hemagglutinin for cell entry indicating that bat influenza A virus can utilize human proteases for hemagglutinin activation. PMID: 27028521
  23. The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia PMID: 26978019
  24. TMPRSS2 isoform 1 is expressed in viral target cells. PMID: 26379044
  25. The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition PMID: 26026052
  26. The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer. PMID: 26615022
  27. Results indicate that PTEN loss occurs in cooperation with TMPRSS2-ERG fusion in prostate cancer and the majority of the samples harbor TMPRSS2-ERG fusion as well as PTEN gene deletion. PMID: 26424596
  28. Elucidation of ERG regulation of ABEs in castration-resistant prostate cancer (CRPC) may help to stratify TMPRSS2-ERG fusion-positive prostate cancer patients in the clinic for anti-androgen receptor-driven therapies. PMID: 25754347
  29. these data show that the androgen-driven events causing TMPRSS2-ERG fusions and other rearrangements of androgen-dependent genes in prostate epithelial cells of young patients preferentially lead to low-grade (and not high-grade) prostate cancer. PMID: 25015038
  30. TMPRSS2-ERG fusion gene transcript was found in 63, 55 and 73% of the prostate cancer cases on urine alone, biopsy rinse material alone and paired samples, respectively. PMID: 24997128
  31. Genetic inhibition of TMPRSS2-ERG junction oncogene in prostate cancer by means of siRNA has strong antineoplastic effect in a mouse model and in vitro. PMID: 25933120
  32. Data showed that TMPRSS2 expression is not only dramatically increased in the primary cancers of patients but TMPRSS2 immunopositivity is also directly correlated with cancer pain severity in these patients. PMID: 25734995
  33. High AR gene copy number emerges during the development of Small cell carcinoma of the prostate, often in association with TMPRSS2-ERG rearrangement. PMID: 24777847
  34. Both IHC and qRT-PCR are useful tools in detecting TMPRSS2:ERG fusions. PMID: 25007891
  35. Membrane bound meprin Beta is activated by transmembrane serine protease matriptase-2 at the cell surface. PMID: 26251449
  36. Data indicate that inhibition of transcriptional regulator ERG protein expression in transmembrane protease serine 2 protein (TMPRSS2):ERG-positive prostate cancer cells increased neuroendocrine cell gene expression. PMID: 25263440
  37. TMPRSS2 promotes the growth, invasion, and metastasis of prostate cancer cells via matriptase activation and extracellular matrix disruption. PMID: 26018085
  38. Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement. PMID: 25977336
  39. The TMPRSS2 Met160Val polymorphism is a genetic risk factor for sporadic prostate cancer in a Japanese population. PMID: 25040002
  40. The expression levels of the TMPRSS2-ERG fusion is related to a more aggressive phenotype, have an effect on prognosis and could be molecular markers of progression for prostate cancer. PMID: 25939480
  41. Results provide suggestive evidence that men with TMPRSS2:ERG positive tumors may have longer prostate cancer survival after ADT. PMID: 25728532
  42. recent and maximum BMI are inversely associated with the odds of developing T2E-positive prostate cancer, but no associations were observed for T2E-negative prostate canc PMID: 25852077
  43. TMPRSS2-ERG gene fusions induce prostate tumorigenesis by modulating microRNA miR-200c. PMID: 24186205
  44. activates hepatitis C virus infection at the postbinding and entry stage PMID: 25203900
  45. results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus PMID: 25175909
  46. The effect of TMPRSS2/ERG gene fusions had differing effects on radiosensitivity and chemosensitivity depending on cell line and fusion type. PMID: 21394739
  47. These findings indicate that TMPRSS2-ERG may or may not lead to prostate cancer development PMID: 24961351
  48. Report prognostic value of tissue/urinary TMPRSS2-ERG levels in prostate neoplasms. PMID: 24072184
  49. concurrent in situ detection of gene expression, point mutations, and gene fusions of the prostate cancer relevant targets TMPRSS2-ERG PMID: 24931216
  50. TMPRSS2:ERG gene fusion synergizes with the VDR to induce CYP24A1 expression-limiting VDR signaling. PMID: 24926821
  51. Prostate cancer specific PCA3 and TMPRSS2-ERG mRNAs are detected in the mononuclear fraction of a castration-resistant prostate cancer patient cohort PMID: 25043536
  52. Our findings suggested that AR CAG repeats are not associated with TMPRSS2:ETS formation in prostate cancer. PMID: 24824408
  53. These observations imply that the frequently noted loss-of-function of NKX3.1 cooperates with the activation of TMPRSS2-ERG fusions in prostate tumorigenesis. PMID: 24418414
  54. Our observations indicate a tight link of NY-ESO-1 expression to ERG activation PMID: 24789172
  55. The presence of single nucleotide polymorphism might have implications on the expression and/or formation levels of TMPRSS2 fusions, because both have been shown to be influenced by androgens. PMID: 24109594
  56. Patients with ERG expression were more likely to develop PCa, with 27 (53%) of 51 ERG-positive and 143 (35%) of 410 ERG-negative patients experiencing progression to PCa. PMID: 24297949
  57. ERG expression correlates with occurrence of TMPRSS2-ERG fusion and with androgen receptor-driven malignant transformation. PMID: 24195515
  58. TMPRSS2-ERG rearrangement occurs in dominant transition zone (TZ) and anterior peripheral zone prostate cancers, with all rearranged TZ cancers in this cohort showing deletion. PMID: 23701505
  59. Results suggest that obesity is linked with poorer prostate cancer prognosis primarily in men with tumors harboring the gene fusion TMPRSS2:ERG. PMID: 24292212
  60. Data indicate combining serum PSA, PCA3, and TMPRSS2:ERG in a multivariable algorithm optimized for clinical utility improved cancer prediction. PMID: 21600800
  61. Coronavirus infection is mediated by the host transmembrane TMPRSS2. PMID: 24027332
  62. characterization of native ERG and Tmprss2:ERG variants reveals that their different oncogenic potential is affected by the status of the Ets domain and the configuration of the 5' UTR region PMID: 23472063
  63. Frequent TMPRSS2-ERG rearrangement occurs in prostatic small cell carcinoma as detected by fluorescence in situ hybridization. PMID: 23850495
  64. presence and expression of TMPRSS2/ERG in prostate stem cells would provide ERG-driven survival advantages, allowing maintenance of this mutated genotype PMID: 23535644
  65. TMPRSS2 and HAT activate HCoV-229E for cathepsin L-independent virus-cell fusion. PMID: 23536651
  66. Nucleotide resolution analysis of TMPRSS2 and ERG rearrangements show strong clustering in specific intronic regions in prostate cancer. PMID: 23447416
  67. This work uncovers significant global epigenetic alterations in TMPRSS2-ERG gene fusion-negative tumors and provides a mechanistic explanation for the tumor formation process. PMID: 22930729
  68. TMPRSS2-ERG fusion accelerates prostatic intraepithelial neoplasia development but not progression to adenocarcinoa. PMID: 22860005
  69. Analysis using the four-color FISH assay provides sensitive detection of TMPRSS2 and ERG gene rearrangements in prostate cancer. PMID: 23352841
  70. TMPRSS2/ERG gene fusion is found in patients with benign prostatic hyperplasia and normal prostate but is significantly increased in prostate cancer samples. PMID: 22674214
  71. The transmembrane protease, serine 2:ets-related gene (TMPRSS2:ERG) gene fusion leads to the overexpression of ERG, an E-twenty six (ETS) family transcription factor, and is the most prevalent genetic lesion in prostate cancer. PMID: 22993300
  72. TMPRSS2:ERG, or ERG overexpression, is associated with tumor stage but does not strongly predict recurrence or mortality among men treated with radical prostatectomy. PMID: 22736790
  73. TMPRSS2 and HAT are expressed by important influenza and SARS-coronavirus target cells and could thus support viral spread in the human host. PMID: 22558251
  74. Downregulation of PSMA in androgen-treated VCaP cells appears partially mediated by TMPRSS2-ERG gene fusion. PMID: 21731703
  75. This study demonstrates a close relationship of the TMPRSS2-ERG gene fusion status between primary and metastatic prostate cancer. PMID: 21937078
  76. Cathepsins B and L activate Ebola but not Marburg virus glycoproteins for efficient entry into cell lines and macrophages independent of TMPRSS2 expression. PMID: 22222211
  77. TMPRSS2-ERG fusion was not prognostic for recurrence after retropubic radical prostatectomy for clinically localized prostate cancer, although men with ERG gene copy number gain without fusion were twice more likely to recur. PMID: 21743434
  78. Suggest that the oncogenic gene fusion TMPRSS2:ERG does not occur in ovarian cancer relative to prostate cancer. PMID: 22076164
  79. Prostate specific TMPRSS2-ERG fusion was found in circulating tumor cells but did not predict for response to abiraterone acetate treatment. PMID: 21802835
  80. BR-DIM and CDF inhibited the signal transduction in the AR/TMPRSS2-ERG/Wnt signaling network, leading to the inactivation of Wnt signaling consistent with inhibition of prostate cancer cell invasion PMID: 21680704
  81. TMPRSS2-ERG gene fusion was found in prostatic small cell carcinoma and adenocarcinoma, but was absent in bladder small cell carcinoma PMID: 21499238
  82. TMPRSS2-ERG fusion gene status and relative 8q gain were assessed by fluorescent in situ hybridization in whole formalin fixed paraffin-embedded biopsies PMID: 21584900
  83. Knockdown of TMPRSS2-ERG in VCaP cells resulted in the downregulation of wild-type ERG transcription, whereas stable overexpression of TMPRSS2-ERG in the gene fusion-negative PC3 cells was associated with the upregulation of wild-type ERG transcript PMID: 21676887
  84. We found that ERG immunohistochemical expression has a high accuracy for defining the TMPRSS-ERG fusion status. PMID: 21677539
  85. The authors show that TMPRSS2 might promote viral spread and pathogenesis by diminishing viral recognition by neutralizing antibodies and by activating SARS S for cell-cell and virus-cell fusion. PMID: 21325420
  86. The gene fusions TMPRSS2 and E26 are present in over 50% of patients with prostate cancer. [Review] PMID: 21377967
  87. The prevalence and class of TMPRSS2-ERG are significantly different in prostate cancer of Caucasian, African-American, and Japanese patients. PMID: 20878952
  88. The recent discovery and subsequent characterization of recurrent gene rearrangements of ETS genes - most frequently ERG - in the majority of prostate cancers is a milestone in translational prostate cancer research. PMID: 20798944
  89. TMPRSS2 is responsible for Influenza A HA cleavage in Calu-3 airway cells. PMID: 21123387
  90. ACE2 and TMPRSS2 colocalized on cell surfaces and enhanced the cell entry of authentic severe acute respiratory syndrome corona virus. PMID: 21068237
  91. we demonstrate that most human prostatic small cell carcinomas carry the TMPRSS2-ERG gene fusion, confirming the involvement of this gene fusion in prostatic SCC. PMID: 21040948
  92. Prostate cancer with large cribriform glands revealed rare TMPRSS2-ERG gene fusion PMID: 20800881
  93. Data suggest that TMPRSS2, an apical surface serine protease, may have a normal role in male reproduction as a component of prostasomes. PMID: 20382709
  94. RNAi-mediated knockdown of TMPRSS2 and TMPRSS4 in Caco-2 cells, which released fully infectious virus without trypsin treatment, markedly reduced the spread of influenza virus, demonstrating that these proteases were responsible for activation of HA. PMID: 20631123
  95. There was no association between TMPRSS2:ERG fusion and prognosis in prostate cancer patients primarily treated by endocrine PMID: 20442300
  96. This is the first study to report concurrent TMPRSS2 and SLC45A3 rearrangements in the same tumor focus in prostate cancer PMID: 20118910
  97. the up-regulation of TMPRSS2 and the down-regulation of KLK11 in advanced and more aggressive tumors may open the feasibility of being used as biomarkers distinguishing the tumor aggressiveness as well as novel prognostic indicators for prostate cancer. PMID: 19242826
  98. A significantly reduced expression of TMPRSS2 was evident in malignant cells harboring TMPRSS2-ERG fusion, but not in prostate cancer cells without TMPRSS2-ERG fusion, further defining these two genetically distinct types of prostate cancer. PMID: 19597533
  99. TMPRSS2-ERG T1/E4 fusion-positive tumours had differentially regulated mRNAs observed in multiple studies. PMID: 20068566
  100. SMARCD1/BAF60a is an androgen receptor cofactor that modulates TMPRSS2 expression PMID: 19762545

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Transmembrane protease serine 2 catalytic chain: Secreted
Protein Families Peptidase S1 family
Tissue Specificity Highly expressed in prostate epithelial cells and in prostate cancers. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland.
Database Links

HGNC: 11876

OMIM: 602060

KEGG: hsa:7113

STRING: 9606.ENSP00000381588

UniGene: Hs.439309

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1