Recombinant Human Transmembrane protein 119 (TMEM119), partial

In Stock
Code CSB-MP023686HUd9
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TMEM119
Uniprot No.
Research Area
Others
Alternative Names
TMEM119; PSEC0199; UNQ731/PRO1415; Transmembrane protein 119; Osteoblast induction factor; OBIF
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26–96aa
Target Protein Sequence
RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
36.3 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human TMEM119 contains amino acids 26–96. The expected molecular weight for the TMEM119 protein is calculated to be 36.3 kDa. The TMEM119 protein was expressed in mammalian cell. The C-terminal hFc tag was fused into the coding gene segment of TMEM119, making it easier to detect and purify the TMEM119 recombinant protein in the later stages of expression and purification.

The human transmembrane protein 119 (TMEM119) is a membrane-associated protein primarily expressed in microglia, which are immune cells in the central nervous system. TMEM119 serves as a marker for microglia, and its expression is associated with the homeostatic state of these cells. Microglia play crucial roles in immune responses within the brain and contribute to the maintenance of neural tissue integrity. Understanding TMEM119 expression and its association with microglial function is essential in unraveling the complex interactions between the immune system and the nervous system. Research on TMEM119 contributes to insights into microglial biology and its implications in neuroinflammatory and neurodegenerative conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in bone formation and normal bone mineralization. Promotes the differentiation of myoblasts into osteoblasts. May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. Upregulates the expression of ATF4, a transcription factor which plays a central role in osteoblast differentiation. Essential for normal spermatogenesis and late testicular differentiation.
Gene References into Functions
  1. TMEM119 expression in osteosarcoma tissues is positively correlated with cell cycle, apoptosis, metastasis and TGF-beta signaling. PMID: 28496199
  2. TMEM119 serves as a reliable microglial marker that discriminates resident microglia from blood-derived macrophages in the human brain PMID: 26250788
  3. qPCR showed that TMEM119 expression was highly enriched in temporal lobe CD11b+ cells over unpurified whole brain, and barely detectable in peripheral blood leukocytes. PMID: 26884166
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Endoplasmic reticulum membrane.
Tissue Specificity
Expressed in brain microglia (at protein level). Elevated expression levels seen in the brain of patients with Alzheimer disease. Expressed by osteoblast-like cells in bone tissues and follicular dendritic cells in lymphoid tissues.
Database Links

HGNC: 27884

KEGG: hsa:338773

UniGene: Hs.449718

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*