Recombinant Human Trefoil factor 1 (TFF1)

In Stock
Code CSB-EP023431HU
Abbreviation Recombinant Human TFF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023431HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TFF1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023431HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TFF1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
BCEI; Breast cancer estrogen inducible protein; Breast cancer estrogen inducible sequence; Breast cancer estrogen-inducible protein; D21S21; Gastrointestinal trefoil protein; Gastrointestinal trefoil protein pS2; hP1.A; HP1A; HPS 2; HPS2; pNR 2; PNR-2; pNR2; Polypeptide P1.A; Protein pS2; PS 2; pS2; pS2 protein; TFF 1; TFF1; TFF1_HUMAN; Trefoil factor 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-84aa
Target Protein Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 25-84 form the expressed segment for recombinant Human TFF1. This TFF1 protein is theoretically predicted to have a molecular weight of 33.7 kDa. The TFF1 protein was expressed in e.coli. The TFF1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant TFF1 protein in following stages of expression and purification.

Trefoil factor 1 (TFF1) is primarily expressed in the gastrointestinal tract, particularly in the stomach, where it plays a role in maintaining mucosal integrity and promoting the healing of damaged epithelia. TFF1 is involved in protecting the mucosa from various insults, such as acidic conditions and mechanical stress. TFF1 is associated with mucin glycoproteins and contributes to the formation of a protective mucous layer on the epithelial surfaces. Beyond its role in gastric mucosal protection, TFF1 has been implicated in diverse physiological and pathological processes, including wound healing, inflammation, and cancer. Research areas related to TFF1 encompass investigations into its molecular mechanisms, its involvement in gastrointestinal diseases, and its potential as a diagnostic or therapeutic target in cancer and other conditions affecting mucosal tissues. Understanding the functions of TFF1 provides insights into the complex interplay between mucosal defense mechanisms and various disease states.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Gene References into Functions
  1. Findings suggest that the hypoxic conditions, which can be induced by gastric injury, promote TFF1 up-regulation, strengthened by an auto-induction mechanism, and that the trefoil peptide takes part in the epithelial-mesenchymal transition events eventually triggered to repair the damage. PMID: 29997345
  2. The urine TFF1 and TFF3 levels significantly increased with the progression of chronic kidney disease stages, but not the urine TFF2 levels. PMID: 29850501
  3. Study shows that TFF1 expression is silenced in early phases of esophageal squamous cell carcinoma (ESCC) development, which seems to be mediated at least in part by promoter hypermethylation, and provides the basis for the use of TFF1 expression as a potential biomarker for early ESCC detection. PMID: 29296124
  4. these data suggest that TFF1 might help cells to counteract Helicobacter colonization and the development of a chronic inflammation. PMID: 29085807
  5. Co-expression of GKN2 and TFF1 massively suppressed the expression of positive cell cycle regulators and induced G1/S arrest, synergistically enhancing the inhibition of cell viability and proliferation of gastric cancer cells PMID: 28150071
  6. The data suggest that the tumor suppressor activity of both RUNX1t1 and TFF1 are mechanistically connected to CEBPB and that cross-regulation between CEBPB-RUNX1t1-TFF1 plays an important role in gastric carcinogenesis. PMID: 27522676
  7. Low TFF1 expression is associated with retinoblastoma. PMID: 28481041
  8. The results suggest that the analysis of expression of MUC5AC and TFF1 may be useful for differentiating sessile serrated adenomas/polyps (SSA/Ps) from hyperplastic polyps (HPs). PMID: 28430953
  9. TFF1 displays a distinct protein expression pattern in the developing of airway remodeling due to Sulfur mustard inhalation and plays an important role in maintaining the airway epithelium function PMID: 27921407
  10. we found TFF1 plays an oncogenic role in mucinous ovarian cancer PMID: 26617749
  11. These results show increased levels of TFF1 and TFF3 in Chronic Kidney Disease patients with a pronounced elevation of urinary TFF1 in lower Chronic Kidney Disease stages. PMID: 26390128
  12. Loss of TFF1 could be a critical step in promoting the H. pylori-mediated oncogenic activation of beta-catenin and gastric tumorigenesis. PMID: 25980439
  13. We have established a novel, three-protein biomarker panel that is able to detect patients with early-stage pancreatic cancer in urine specimens:LYVE-1, REG1A, and TFF1 were selected as candidate biomarkers PMID: 26240291
  14. These findings suggest that the rs184432 and rs225359 polymorphisms in TFF1 have protective effects for GC and contribute to the development of GC in Korean individuals. PMID: 26240479
  15. Findings underscore an important protective role of TFF1 in abrogating H. pylori-mediated inflammation, a crucial hallmark of gastric tumorigenesis. Loss of TFF1 expression could be an important step in H. pylori-mediated gastric carcinogenesis. PMID: 26372254
  16. This study provides a potent tool of rTFF1 production to be applied in gastric damage protection and wound healing. The protein sources from B. choshinensis were more efficient than rTFF1 produced by E. coli PMID: 25990322
  17. trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3 PMID: 26276775
  18. Data indicate that microRNA miR218-5p negatively regulates trefoil factor 1 (TFF1) in an extracellular signal-regulated kinases Erk1/2-dependent manner. PMID: 25652124
  19. Trefoil Factor 1 levels can influence copper excretion and copper related toxicity. PMID: 25486181
  20. data clearly show that the expression of TFF3 in retinoblastoma cell lines is epigenetically regulated, whereas the level of TFF1 and TFF2 seems to be regulated by other or additional mechanisms PMID: 25199519
  21. Western blot analysis data demonstrated that miR-504 abrogates TFF1-induced p53 protein expression and activity. PMID: 25015107
  22. overexpressed in chronic rhinosinusitis without nasal polyps PMID: 24733740
  23. Immunohistochemical expression of ERalpha, ERbeta, and TFF1 in type I and II ovarian tumors. PMID: 24162262
  24. Determination of TFF1 status might identify patients at different risk for relapse and help in making decision on administering adjuvant therapy for early breast cancer patients during the first 3 years of follow-up. PMID: 24843314
  25. Retinoblastoma cell lines with high TFF1 expression levels exhibited a selective down-regulation of cyclin-dependent kinase (CDK) 6, whereas CDK4 and CDK2 seem to be unaffected by TFF1 expression. PMID: 22983508
  26. Piezo1 is a novel TFF1 binding protein that is important for TFF1-mediated cell migration in gastric cancer cells. PMID: 24798994
  27. the C-terminus of TFF1, involved in the binding of copper, is also able to selectively bind H. pylori RF-LPS. PMID: 24236136
  28. High TFF1 expression is associated with doxorubicininduced apoptosis resistance. PMID: 23836323
  29. miRNA-423-5p negatively regulated the expression of TFF1 by binding to its 3'UTR and participated in proliferation/invasion-related processes via a TFF1-dependent manner in gastric cancer cells PMID: 24486742
  30. TFF1 missense mutations seem to be a rare event in colorectal carcinogenesis. However, serum TFF1 levels were significantly elevated in patients with colorectal carcinoma. Serum TFF1 may be a potential useful marker for patients with colorectal carcinoma. PMID: 24503794
  31. Analysis of TFF1 levels dynamics revealed that TFF1 levels kept steady state during the 5-day period. TFF1 levels were similar in patients with SIRS, sepsis and severe sepsis PMID: 23627615
  32. MSK1 and MSK2 are required for maximal TFF 1 induction. PMID: 23675462
  33. downregulation of TFF1 expression during gastric neoplastic transformation is associated with activation of the NF-kappaB pathway PMID: 23942618
  34. TFF1 expression is silenced by DNA methylation and is associated with tumor invasion and a poor survival in gastric cancer patients. PMID: 23291975
  35. Reduced expression of TFF1 and increased expression of TFF3 may play a role in the carcinogenesis of gastric cancer. PMID: 23329884
  36. There is no direct molecular interaction between GKN1 and TFF1 in protein level in gastric cancer. PMID: 22842654
  37. The capacity of TFF1 to enhance prostate cancer cell migration/invasion is mediated by transcriptional repression of E-CADHERIN. PMID: 23266572
  38. The expression of TFF1 protein increases in gastric ulcer but decreases in gastric ulcerocancer. PMID: 22944057
  39. Report TFF1 expression in normal/diseased pancreas. PMID: 22286382
  40. Over-expression of TFF1 could promote apoptosis of three cell lines and inhibit proliferation but had no pronounced effect on cell cycle PMID: 22642590
  41. gastrointestinal tract specific gene GDDR might inhibit gastric cancer growth in a TFF1 dependent manner. PMID: 21870107
  42. PIMT may act as a co-activator in ERalpha-mediated transcription of TFF1 through its recruitment to the promoter via interacting with ERalpha. PMID: 22382029
  43. TFF1 promoter methylation is identified as a potential early marker of esophageal squamous cell carcinoma (ESCC). PMID: 21946330
  44. We found a statistically significant increased risk of gastric cancer associated with -394 TT genotypes PMID: 22093877
  45. documented the extent and timing of TFF1 expression in pancreatic ductal adenocarcinoma PMID: 21747314
  46. expression of TFF1 stimulated the migration and invasion in the four cell lines. Forced TFF1 expression in MCF10A, MDA-MB-231 and MCF7 cells did not modify anchorage-dependent or -independent cell proliferation PMID: 21358676
  47. The TFF1 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells. PMID: 20494980
  48. TFF mRNA/protein expression is indicative of cholangiocarcinoma progression, but not predictive for histological sub-type or survival time. PMID: 21472131
  49. Data show that genes overexpressed in breast carcinoma including TFF1, TFF3, FOXA1 and CA12. PMID: 20132413
  50. loss of TFF1 leads to activation of IKK complex-regulated NF-kappaB transcription factors and is an important event in shaping the NF-kappaB-mediated inflammatory response during the progression to gastric tumorigenesis PMID: 21490402

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g
Database Links

HGNC: 11755

OMIM: 113710

KEGG: hsa:7031

STRING: 9606.ENSP00000291527

UniGene: Hs.162807

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*