Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
BCEI; Breast cancer estrogen inducible protein; Breast cancer estrogen inducible sequence; Breast cancer estrogen-inducible protein; D21S21; Gastrointestinal trefoil protein; Gastrointestinal trefoil protein pS2; hP1.A; HP1A; HPS 2; HPS2; pNR 2; PNR-2; pNR2; Polypeptide P1.A; Protein pS2; PS 2; pS2; pS2 protein; TFF 1; TFF1; TFF1_HUMAN; Trefoil factor 1
Species
Homo sapiens (Human)
Expression Region
25-84aa
Target Protein Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 25-84 form the expressed segment for recombinant Human TFF1. This TFF1 protein is theoretically predicted to have a molecular weight of 33.7 kDa. The TFF1 protein was expressed in e.coli. The TFF1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant TFF1 protein in following stages of expression and purification.
Trefoil factor 1 (TFF1) is primarily expressed in the gastrointestinal tract, particularly in the stomach, where it plays a role in maintaining mucosal integrity and promoting the healing of damaged epithelia. TFF1 is involved in protecting the mucosa from various insults, such as acidic conditions and mechanical stress. TFF1 is associated with mucin glycoproteins and contributes to the formation of a protective mucous layer on the epithelial surfaces. Beyond its role in gastric mucosal protection, TFF1 has been implicated in diverse physiological and pathological processes, including wound healing, inflammation, and cancer. Research areas related to TFF1 encompass investigations into its molecular mechanisms, its involvement in gastrointestinal diseases, and its potential as a diagnostic or therapeutic target in cancer and other conditions affecting mucosal tissues. Understanding the functions of TFF1 provides insights into the complex interplay between mucosal defense mechanisms and various disease states.