Recombinant Human Triggering receptor expressed on myeloid cells 1 (TREM-1), partial

Code CSB-MP024404HU
Abbreviation Recombinant Human TREM1 protein, partial
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Triggering receptor expressed on monocytes 1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-200aa
Target Protein Sequence
ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.6 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses. Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimerizes and forms a complex with transmembrane adapter TYROBP/DAP12. In turn, initiates a SYK-mediated cascade of tyrosine phosphorylation, activating multiple downstream mediators such as BTK, MAPK1, MAPK3 or phospholipase C-gamma. This cascade promotes the neutrophil- and macrophage-mediated release of proinflammatory cytokines and/or chemokines, as well as their migration and thereby amplifies inflammatory responses that are triggered by bacterial and fungal infections. By also promoting the amplification of inflammatory signals that are initially triggered by Toll-like receptor (TLR) and NOD-like receptor engagement, plays a major role in the pathophysiology of acute and chronic inflammatory diseases of different etiologies including septic shock and atherosclerosis.; Acts as a decoy receptor, counterbalancing TREM1 proinflammatory activity through the neutralization of its lignad.
Gene References into Functions
  1. These data show that human macrophages infected with human immunodeficiency virus-1 show an increased expression of TREM-1. In parallel, direct exposure to the human immunodeficiency virus-1-related proteins Tat or gp120 induces TREM-1 expression in macrophages and confers anti-apoptotic attributes. PMID: 28181540
  2. Current data suggest that sTREM-1 might become a useful biomarker for the prediction of neonatal sepsis; however, the significant variation in the used threshold values (that ranged between 77.5 and 1707.35 pg/ml) and the methodological differences across studies limit the value of our findings in clinical practice.[Review] PMID: 29644420
  3. TREM-1 is a predictive biomarker of in-stent restenosis and an important mediator of cellular inflammation, migration, and proliferation in vascular smooth muscle cells PMID: 29080545
  4. The present study highlights the role of urine sTREM-1 levels in late-onset sepsis. PMID: 29480083
  5. TREM-1 links dyslipidemia to inflammation and lipid deposition in atherosclerosis. PMID: 27762264
  6. serum levels seem higher in newly diagnosed type 1 diabetes patients than in their healthy siblings (not statistically significant) PMID: 27862781
  7. TREM-1 interventions by means of LP17, LR12 and TREM-1 fusion protein did not ameliorate IR-induced injury. In the human renal transplant cohort, donor and recipient TREM1 gene variant p.Thr25Ser was not associated with DGF, nor with biopsy-proven rejection or death-censored graft failure. We conclude that TREM-1 does not play a major role during experimental renal IR and after kidney transplantation PMID: 27928159
  8. TREM-1 plays an important role in mediating platelet activation. PMID: 28837205
  9. Serum sTREM-1 level is significantly higher in diarrhea-predominant irritable bowel syndrome (D-IBS) patients and positively correlates with abdominal pain, which may be initiated by TREM-1-associated macrophage activation, indicating the existence of subclinical inflammation in D-IBS. PMID: 29516326
  10. TREM-1 overexpression and M1 macrophage polarization are associated with obesity-induced insulin resistance. PMID: 28454543
  11. TREM-1 may have a role in pathology of craniopharyngioma and Rathke's cleft cyst PMID: 27409178
  12. low expression level of TREM-1 might be a characteristic for tumor-associated macrophages in lung cancer PMID: 27244892
  13. The results demonstrate that both commensal and pathogenic oral bacteria activate the TREM-1 pathway, resulting in a proinflammatory TREM-1 activity-dependent increase in proinflammatory cytokine production. PMID: 27448788
  14. Our findings suggest a novel modulatory role of TREM-1 in the pathogenesis of SLE. sTREM-1 production is a useful diagnostic marker and a molecular target for combination therapy of lupus. PMID: 28089248
  15. In the premature rupture of membranes group,the NF-kappaB p65 and sTREM-1 levels in maternal blood were significantly higher in women with chorioamnionitis than women without chorioamnionitis (P<.05). PMID: 27521929
  16. Diagnostic value of sTREM-1, IL-8, PCT, and CRP in febrile neutropenia after autologous stem cell transplantation PMID: 28920169
  17. findings showed detectable expression of TREM-1 in 100% of samples, urinary tract infection (UTI) and non-UTI groups; levels of sTREM-1 were detected in patients with UTI, but not in non-UTI patients; TREM-1 levels in patients with UTI tend to be higher and are associated with increased neutrophils and cytokine activity induced by bacteria PMID: 28367708
  18. The minor allele T of rs2234246 of TERM1 protein, was associated with increased sTREM-1 in the discovery population, explaining 33% of its variance, and with increased levels of mRNA. PMID: 28771614
  19. This study provided evidence that rs6910730G, an intronic variant of TREM1, reduced the ability of human monocytes for Abeta phagocytosis, and this reduction was likely attributed to a decreased monocytic TREM1 expression. PMID: 27670763
  20. Studies show that bronchoalveolar lavage fluid (BALF) soluble triggering receptor expressed on myeloid cells-1 (sTREM-1) levels do not discriminate between mild-to-moderate asthma and chronic obstructive pulmonary disease (COPD), in contrast, the interleukin 6 (IL-6)/interleukine 13 (IL-13) ratio measured in BALF effectively differentiated these two diseases. PMID: 28791839
  21. study found that soluble TREM-1 is increased and correlates with the clinical and laboratory findings in Crimean Congo Haemorrhagic Fever, a viral infection characterized by activation of inflammation. PMID: 26877157
  22. The findings suggest that there are no differences in soluble TREM-1 levels in gingival crevicular fluid between healthy and periodontally diseased elderly adults PMID: 27542376
  23. TREM-1 was found to be significantly higher in tissues biopsies and blood of subjects with obesity. Greater expression and activity of TREM-1 suggest a possible role in the underlying pathophysiology of obesity and associated comorbidities. PMID: 28111922
  24. This study indicates that in children with community-acquired pneumonia, sTREM-1, Midregional-proANP, and Midregional-proADM blood levels have poor abilities to differentiate bacterial from viral diseases or to identify severe cases. PMID: 27846213
  25. Carriage of the TREM1 rs2234237T allele appears to be a risk factor for the development of severe malaria. PMID: 27671831
  26. TREM-1, HMGB1 and RAGE in the Shoulder Tendon: Dual Mechanisms for Inflammation Based on the Coincidence of Glenohumeral Arthritis PMID: 27792788
  27. is concluded that both HMGB1 and sTREM-1 are released during the inflammatory response of periodontal tissues and they can promote inflammatory process, which leads to tissue destruction. PMID: 27917624
  28. The soluble TREM-1 level, core temperature and SAPS II value were the only independent predictors of death after adjustment for potential confounders in sepsis patients admitted to intensive care. PMID: 27729010
  29. TREM-1 plays a critical role in osteoarthritis development and IL1B induced chondrocyte injury through regulation of NF-kappaB signaling PMID: 27932245
  30. sTREM1 was increased in septic patients with myocardial depression compared to those without myocardial depression. PMID: 27238916
  31. this study shows higher levels of TREM-1 in plasma of systemic lupus erythematosus in Egyptian patients PMID: 27648678
  32. Increased expression of TREM-1 in S compared to AS patients involving TNFa, MMP-1 and MMP-9 suggest a potential role of TREM-1 in plaque destabilization PMID: 27017522
  33. decreased serum level significantly associated with the presence and severity of coronary artery disease; restrains inflammatory reaction in endothelial cells PMID: 27631216
  34. Plasma levels of sTREM-1 were found to identify patients with septic shock more effectively than procalcitonin and C-reactive protein. Moreover, sTREM-1 was identified to be an early predictor for survival in patients with septic shock. PMID: 27319606
  35. This study provides new insights into the possible mechanism of TREM-1 and HIF-1alpha in psoriasis. PMID: 27743451
  36. TREM-1 may play an important role in the inflammatory cascade after subarachnoid hemorrhage and act as a monitoring biomarker PMID: 27697433
  37. This study shows increased expression of TREM-1 in monocytes from patients with advanced cervical cancer. PMID: 26506490
  38. TREM-1 expression is decreased during the generation of human osteoclast precursors PMID: 26852644
  39. TREM-1 activation may be involved in the development of Kawasaki disease. PMID: 27324541
  40. LPS-induced TREM-1 transcription. PMID: 26397033
  41. The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases. PMID: 27096761
  42. TREM-1 and Dectin-1 function concurrently in the corneal innate immune response by regulating inflammatory cytokine expression in fungal keratitis. PMID: 26963514
  43. High TREM-1 expression correlated significantly with increased recurrence in hepatocellular carcinoma. PMID: 25465376
  44. Soluble TREM-1 level is significantly increased in hemodialysis patients as are other pro-inflammatory markers. PMID: 26495896
  45. TREM-1 is induced by MSU and is associated with the inflammation of human acute gouty arthritis. PMID: 26320130
  46. Plasma and urine TREM-1 levels can be used as diagnostic biomarkers for acute kidney injury in critically ill patients with sepsis. PMID: 25944130
  47. study found no association between the other investigated SNPs within TREM-1 gene and infective endocarditis risk PMID: 25213166
  48. In neonates with late-onset neonatal sepsis, soluble TREM-1 has the potential to provide an excellent predictive value for septic shock/death. PMID: 25461656
  49. Soluble TREM-1, a member of the immunoglobulin super-family, is upregulated when neutrophils are exposed to bacteria. PMID: 25294884
  50. isolated PMNs have an increased proportion of both TREM1 and DAP12 compared to normal healthy control PMID: 25642940

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Tissue Specificity
Mostly expressed by immune cells of the myeloid lineage, such as monocytes, macrophages, neutrophils and dendritic cells. Expression is associated with a mature stage of myeloid development. Highly expressed in adult liver, lung and spleen than in corresp
Database Links

HGNC: 17760

OMIM: 605085

KEGG: hsa:54210

STRING: 9606.ENSP00000244709

UniGene: Hs.283022

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*