Recombinant Human Tripartite motif-containing protein 29 (TRIM29), partial

In Stock
Code CSB-EP618875HU
Abbreviation Recombinant Human TRIM29 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TRIM29
Uniprot No.
Research Area
Cancer
Alternative Names
Ataxia telangiectasia group D-associated protein
Source
E.coli
Expression Region
239-588aa
Target Protein Sequence
DQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.1 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a crucial role in the regulation of macrophage activation in response to viral or bacterial infections within the respiratory tract. Mechanistically, TRIM29 interacts with IKBKG/NEMO in the lysosome where it induces its 'Lys-48' ubiquitination and subsequent degradation. In turn, the expression of type I interferons and the production of proinflammatory cytokines are inhibited. Additionally, induces the 'Lys-48' ubiquitination of STING1 in a similar way, leading to its degradation.
Gene References into Functions
  1. decreased expression of miR-122 and increased expression of TRIM29 was significantly associated with poor prognosis in patients with NPC. PMID: 29693120
  2. Ectopic expression of TRIM29 potentially contributes to metastasis and poor prognosis in patients with osteosarcoma. PMID: 28731167
  3. Knockdown of tripartite motif-containing 29 protein (TRIM29) enhanced the production of type I interferon in human and mouse dendritic cells by up to fourfold in response to intracellular herpes simplex virus. PMID: 29038422
  4. the current study demonstrated that TRIM29 upregulates cyclin and Bcl family proteins level to facilitate malignant cell growth and inhibit drug-induced apoptosis in bladder cancer, possibly through PKC-NF-kappaB signaling pathways. PMID: 26987391
  5. High TRIM29 expression is associated with metastasis of nasopharyngeal carcinoma. PMID: 26872369
  6. Data show that TRIM29 promotes tumor progression by activating Wnt/beta-Catenin signaling. PMID: 27081037
  7. This study establishes TRIM29 as a hypoxia-induced tumor suppressor gene and provides a novel molecular mechanism for ATM-dependent breast cancer suppression. PMID: 27535224
  8. Upregulation of TRIM29 is associated with thyroid cancer. PMID: 28098872
  9. miR-761 acts as an oncogene in triple-negative breast cancer. This mode of action can, at least partially, be ascribed to the down-regulation of its target TRIM29. PMID: 28054302
  10. Silencing of TRIM29 significantly inhibited the migration and invasion ability of CRC cells. PMID: 27430345
  11. Findings established a role for ATDC/TRIM29 as a robust pathogenic driver of bladder cancer development, identified downstream effector pathways, and implicated ATDC as a candidate biomarker and therapeutic target. PMID: 26471361
  12. define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC PMID: 26381412
  13. Results suggest that TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185. PMID: 26191199
  14. TRIM29 functions as a scaffold protein to assemble DNA repair proteins into chromatin followed by efficient activation of DNA damage response. PMID: 26095369
  15. These findings suggest that TRIM29 regulates the p63-mediated pathway and the behavior of cervical cancer cells. PMID: 26071105
  16. Down-regulation of ATDC inhibits the growth and proliferation of esophageal carcinoma cells. PMID: 25491629
  17. TRIM29 may be useful marker for distinguishing prostate cancers from benign tissues PMID: 24485335
  18. TWIST1 inhibited TRIM29 promoter activity. PMID: 24950909
  19. TRIM29 promotes tumor progression and may be a novel prognostic marker for pancreatic ductal adenocarcinoma. PMID: 24864129
  20. Down-regulation of TRIM29 inhibited tumor cell proliferation in vitro. PMID: 24078150
  21. ATDC mRNA and protein expression were significantly higher in esophageal squamous cell carcinoma tissue than in matched noncancerous tissues. PMID: 23020249
  22. Ataxia-telangiectasia group D-associated gene (ATDC) mediates resistance to ionizing radiation. PMID: 24469230
  23. The expressions of TrkB and TRIM29 are correlated with lymph node metastasis in gastric cancer. PMID: 22490895
  24. The interaction between TRIM29 and beta-catenin may participate in the development of lung squamous cell carcinoma. PMID: 22721621
  25. results suggest that loss of TRIM29 expression in normal breast luminal cells can contribute to malignant transformation and lead to progression of ER+ breast cancer in premenopausal women. PMID: 22138580
  26. Histone deacetylase 9 (HDAC9) regulates the functions of the ATDC (TRIM29) protein PMID: 20947501
  27. TRIM29 allows keratinocytes to enter a protective alternative differentiation process rather than die massively after stress. PMID: 20454669
  28. ATDC increases cell proliferation via inhibition of p53 nuclear activities. PMID: 20368352
  29. suppressed ATDC expression is associated with malignant phenotype. PMID: 16890201
  30. TRIM29 is upregulated after radical prostatectomy for prostatic neoplasms. PMID: 17448597
  31. ATDC was found to stabilize beta-catenin via ATDC-induced effects on the Disheveled-2 protein, a negative regulator of glycogen synthase kinase 3beta in the Wnt/beta-catenin signaling pathway. PMID: 19249679
  32. the percentage of lung carcinoma patients remaining unclassifiable by TTF-1/TP63 was twice that of the five-antibody (TRIM29, CEACAM5, SLC7A5, MUC1, and CK5/6) test PMID: 19430419

Show More

Hide All

Subcellular Location
Cytoplasm. Lysosome. Note=Colocalizes with intermediate filaments.
Tissue Specificity
Expressed in placenta, prostate and thymus.
Database Links

HGNC: 17274

OMIM: 610658

KEGG: hsa:23650

STRING: 9606.ENSP00000343129

UniGene: Hs.504115

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*