Recombinant Human Tubulin alpha-4A chain (TUBA4A)

Code CSB-YP025313HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025313HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025313HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025313HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025313HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Alpha-tubulin 1; ALS22; B ALPHA 1; bA408E5.3; H2 ALPHA; Hum a tub1; Hum a tub2; LIS3; MGC171407; MGC55332; TBA4A_HUMAN; Testis-specific alpha-tubulin; TUBA1; TUBA1A; tuba1l; Tuba4a; Tubulin alpha 1 chain; Tubulin alpha; Tubulin alpha-1 chain; tubulin alpha-1B chain; Tubulin alpha-4A chain; Tubulin H2-alpha; Tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; Tubulin, alpha 4a; Tubulin, alpha, testis-specific; Tubulin, alpha-1
Species
Homo sapiens (Human)
Expression Region
1-448
Target Protein Sequence
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Gene References into Functions
  1. Data indicate a microRNA-1825/TBCB/TUBA4A pathway as a putative pathogenic cascade in both familial ALS (fALS) and both sporadic (sALS). PMID: 30030593
  2. The elevated selenium species levels in the TUBA4A patient may have a genetic etiology and/or represent a pathogenic pathway through which this mutation favors disease onset. PMID: 28478440
  3. alphaTubulin expression might be an independent prognostic factor for pancreatic cancer after surgical resection PMID: 27447976
  4. Its mutations were seen in patients with ALS and frontotemporal dementia. PMID: 28069311
  5. TUBA4A mutations are not associated with FTD. PMID: 26675813
  6. In conclusion, our current results did not find an association between TUBA4A and ALS in Chinese patients, and further studies will be required. PMID: 26465396
  7. This study mutational screening revealed the presence of four novel heterozygous variants of TUBA4A mutation in four sporadic amyotrophic lateral sclerosis. PMID: 25893256
  8. Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein. PMID: 26103986
  9. TUBA4A mutants destabilize the microtubule network, diminishing its repolymerization capability PMID: 25374358
  10. TUBA4A is significantly increased in spermatazoa from men with azoospermia. PMID: 24268707
  11. The results suggested that cytoskeletal alterations in the amygdala determined by tubulin seem to be involved in the pathophysiology of drug addiction PMID: 20686780
  12. Subunits of alphaB crystallin that exchange dynamically with the alphaB crystallin complex can interact with tubulin subunits to regulate the equilibrium between tubulin and microtubules. PMID: 20668689
  13. increased levels in paclitaxel-resistant breast cancer cells PMID: 12054644
  14. Some protein-protein interactions in rafts were disrupted in 3-nitrotyrosine-containing proteins, e.g. caveolin-1 was dissociated from a complex with flotillin-1 and alpha-tubulin. PMID: 15934946
  15. Our results suggest that MIZIP might play an important role in mammalian cells by associating with tubulin and thus might provide a link between MCHR1 and tubulin functions. PMID: 16039987
  16. These results provide the first characterisation of endogenously nitrated tubulin from human tumour samples. PMID: 16257120

Show More

Hide All

Involvement in disease
Amyotrophic lateral sclerosis 22, with or without frontotemporal dementia (ALS22)
Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
Tubulin family
Database Links

HGNC: 12407

OMIM: 191110

KEGG: hsa:7277

STRING: 9606.ENSP00000248437

UniGene: Hs.75318

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1