Recombinant Human UDP-glucuronosyltransferase 2B7 (UGT2B7), partial

Code CSB-YP025598HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025598HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025598HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025598HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025598HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
UGT2B7
Uniprot No.
Alternative Names
UGT2B7; UGTB2B9; UDP-glucuronosyltransferase 2B7; UDPGT 2B7; UGT2B7; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronosyltransferase 2B9; UDPGT 2B9; UDPGTh-2
Species
Homo sapiens (Human)
Expression Region
24-429
Target Protein Sequence
GKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTK TELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQES RFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTD QMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWN FQFPHPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANV IASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEA IYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVM KLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLD
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol, estriol, catechol estrogens). Also regulates the levels of retinoic acid, a major metabolite of vitamin A involved in apoptosis, cellular growth and differentiation, and embryonic development. Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II. Also metabolizes mycophenolate, an immunosuppressive agent.
Gene References into Functions
  1. rs7668282 (UGT2B7, T>C) was more prevalent in sodium valproate (VPA)-resistant patients than drug-responsive patients. rs2242480 (CYP3A4, C>T) and rs10188577 (SCN1A, T>C) were more prevalent in drug-responsive patients compared to drug-resistant patients. In children with generalized seizures on VPA therapy, polymorphisms of UGT2B7, CYP3A4, and SCN1A genes were associated with seizure reduction. PMID: 29679912
  2. Review/Meta-analysis: UGT2B7 G211T and C161T polymorphisms were able to affect the pharmacokinetics in epilepsy patients treated with valproic acid PMID: 29243113
  3. Icaritin was subjected to significant glucuronidation, wherein UGT1A3, 1A7, 1A8, 1A9 and 2B7 were main contributing enzymes. PMID: 28443723
  4. This study is the first attempt to investigate the association of genetic polymorphisms of UGT2B7 with anti-tuberculosis drug-induced liver injury (ATLI) in Chinese Han. There is no significant association between UGT2B7 polymorphisms and ATLI in Chinese Han. PMID: 28934901
  5. This study analyzed the genotypes of 195 epilepsy patients, and preliminarily results confirmed the distribution of UGT2B7 *2 genotypes (802 C > T, H268 > Y) in a population of epilepsy patients. Results indicated that polymorphisms in the UGT2B7 *2 gene exert specific effects on the blood concentrations of valproic acid, but not carbamazepine. PMID: 28958730
  6. In summary, we explored the effects of CYP3A5*3, UGT2B7*2, and UGT2B7*3 variants on steady-state carbamazepine (CBZ) concentrations in 62 epileptic patients. Our study found that the UGT2B7*2 variant, but not the CYP3A5*3 and UGT2B7*3 variants, can affect steady-state CBZ concentrations in these patients. PMID: 30045320
  7. Inter-isoform Hetero-dimerization of Human UDP-Glucuronosyltransferases (UGTs) 1A1, 1A9, and 2B7 and Impacts on Glucuronidation Activity PMID: 27857056
  8. These results suggested that ABCB1 rs1045642 and UGT2B7 rs7439366 may affect oxcarbazepine pharmacokinetics and therapeutic efficacy in Han Chinese patients with epilepsy PMID: 28837897
  9. Two copies of haplotype D in the UGT2B7 gene increased venous thrombosis risk as well as Sex-hormone-binding-globulin levels in oral contraceptive users and not in non-users. Genetic variation in the UGT2B7 gene may, in part, explain venous thrombosis risk in combined oral contraceptive users. PMID: 28579309
  10. BDNF enriched in colorectal carcinoma can interact and inhibit UGT2B7 by primarily blocking the positive signals of H3K4Me3 as well as activating H3K27Ac on the promoter region of UGT2B7. PMID: 28418861
  11. We discovered a rare single nucleotide UGT2B7 variant of potential pharmacogenetic relevance that encodes a nonconservative amino acid substitution at codon 121. PMID: 27612916
  12. This study showed that UGT2B7 and UGT2B15 3'-UTRs contain miRNA response elements for multiple miRNAs that may contribute to variable drug glucuronidation. PMID: 28962835
  13. Our findings highlight the influence of UGTT1A4 haplotypes on tamoxifen disposition in Asian breast cancer patients, while genetic variants in UGT2B7 and UGT2B15 appear to be of minor importance. PMID: 27098059
  14. Neither AUC0-150min, ktr, CL, nor VD were associated with genetic variants in OCT1, ABCB1, and UGT2B7 (all P>0.05). PMID: 28063968
  15. This study aimed to analyze the relationship of UGT2B7 and UGT1A4 polymorphisms with metabolism of valproic acid (VPA) and lamotrigine (LTG) in epileptic children. UGT2B7 A268G and C802T polymorphisms were demonstrated to affect the serum concentration of VPA (F=3.147, P=0.047; F=22.754, P=0.000). we found that C802T polymorphism exerted strong effects on efficacy of VPA (chi2=9.265, P=0.010). PMID: 27795544
  16. The CC genotype patients with Uridine Glucuronosyltransferase 2B7 Polymorphism had decreased epirubicin clearance in Early-Stage Breast Cancer. PMID: 26452313
  17. UGT2B7 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes. PMID: 26407805
  18. Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C > T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children PMID: 26303110
  19. Significant differences in mean dose consumption were seen among the genotypic groups of the OPRM1 A118G and UGT2B7 C802T variants. These variants were found to predict codeine consumption in the cohort overall and among Caucasians PMID: 25752520
  20. aprepitant can alter clearance of drugs primarily eliminated by UGT2B7. PMID: 26053558
  21. The presence of the SNP 802C>T UGT2B7 (UGT2B7*2/*2) is associated with a worse analgesic response to transdermal buprenorphine in the postoperative period of thoracic surgery. PMID: 24256307
  22. Results show ticagrelor pharmacokinetics to be influenced by SNPs in UGT2B7 though no detectable effects on efficacy or safety were found PMID: 25935875
  23. This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen PMID: 26176234
  24. These results suggested that UGT2B7 C802T may be an important determinant of individual variability in the pharmacokinetics of VPA PMID: 26088889
  25. This study revealed that three polymorphisms, SCN1A IVS5-91G>A, ABCC2 c.1249 G>A and UGT2B7 c.802T>C, are associated with OXC maintenance dose and lnCDR in Han Chinese epilepsy patients PMID: 25823783
  26. Kinetic analyses revealed very low Km value for 16alpha-hydroxyestrone glucuronidation by UGT2B7, below 4 muM, suggesting higher affinity than commonly found among UGTs and their substrates PMID: 26220143
  27. Provide further evidence supporting UGT2B7 as a p53 target gene. PMID: 25713207
  28. Our small pilot study illustrates that in addition to gestational and postnatal age, the UGT2B7 -900G>A polymorphism significantly alters morphine pharmacokinetics in preterm infants. PMID: 25340733
  29. study reveals UGT2B7 A268G genetic polymorphism distribution in Chinese epilepsy population; UGT2B7 A268G plays an important role in valproic acid (VPA) metabolism, and has certain effects on VPA's serum concentration PMID: 23981985
  30. The list of proteins immunoprecipitated with the anti-UGT2B7 antibody. PMID: 24366439
  31. These data suggest that the UGT2B7 -161C>T polymorphism in pediatric epilepsy patients carrying the CYP2C9*1/*1 genotype affects VPA concentration. PMID: 24365988
  32. We identified three novel single-nucleotide polymorphisms (SNPs) in the UDP-glucuronosyltransferase 2B7 (UGT2B7) gene. PMID: 24561451
  33. A novel autoregulatory mechanism of the UGT2B7 glucuronidation pathway. PMID: 24088326
  34. data indicate UGT2B7 pre-mRNAs are subject to differential splicing in normal, fetal and neoplastic tissues and that 2 mutually exclusive promoters drive UGT2B7 expression; data also indicate a switch toward functional enzyme upon maturation in the kidney and reversal of this process in neoplastic cells PMID: 24128937
  35. Carbinol glucuronidation activity significantly correlated with UGT2B7 protein. PMID: 23965986
  36. By considering COMT, OPRM1, and UGT2B7 genotypes, as well as pharmacokinetic results, only COMT polymorphisms appear to be predictive of morphine need in postoperative pain therapy. PMID: 23686330
  37. log-rank test and hazard ratio were used to reflect association between UGT2B7 802C>T variant and risk of acute graft rejection PMID: 23726609
  38. UGT2B7 SNPs influence lamotrigine pharmacokinetics in Thai patients. PMID: 23263737
  39. Report UGT2B7 expression in fetal/adult tissues. PMID: 23223495
  40. UGT1A9 and 2B7 are the main enzymes involved in ethanol glucuronidation. In addition, our results suggest that cannabinol and cannabidiol could significantly alter ethanol glucuronidation. PMID: 23230132
  41. the UGT2B7*2 variant allele was significantly rarer in Chinese than in Caucasians and Africans PMID: 23700788
  42. There were no differences in VPA dose or adjusted plasma VPA concentrations among the UGT2B7*2 or CYP2C9*3 genotypic groups. PMID: 23099353
  43. These results suggest that N-glycosylation differentially affects the glucuronidation of zidovudine and morphine by human UGT2B7. PMID: 22240840
  44. genetic association studies in pediatric population in United States: Data suggest that combined SNPs in UGT2B7, UGT1A9, and MRP2 are important in pharmacokinetics/biotransformation of prodrug mycophenolate mofetil in kidney transplant recipients. PMID: 23131697
  45. These results suggest that SNPs of the UGT2B7 gene may play important roles in opiate withdrawal symptoms. PMID: 22676193
  46. For both CYP2B6 and UGT2B7 genes, genetic variation was observed among individuals within populations, with the Papua New Guinean population showing the highest values for CYP2B6, and the Asian and European populations showing higher values for UGT2B7. PMID: 22462748
  47. the present study revealed that EPHX1, UGT2B7 and SCN1A genetic polymorphisms simultaneously modulated the CBZ maintenance doses and CDRs(concentration-dose ratios) PMID: 22188362
  48. Data suggest that UGT2B7 is the predominant activity in liver microsomes for haloperidol O-glucuronidation (in both human and rat). PMID: 22028316
  49. In the case of UGT2B7, our results agree with the previously described effect of BSA, namely lowering the K(m) value without a large effect on the enzyme's V(max) value. PMID: 21856742
  50. these findings point toward a significant variability in structure, abundance, and tissue-specific UGT2B7 transcriptome, in addition to novel functions for UGT2B7-derived proteins PMID: 21881541

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
UDP-glycosyltransferase family
Database Links

HGNC: 12554

OMIM: 600068

KEGG: hsa:7364

STRING: 9606.ENSP00000304811

UniGene: Hs.654424

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1