Tel : 301-363-4651 Professional and Accurate! We are your good partner in biology research.

Product Name:

Recombinant Human Ubiquitin-conjugating enzyme E2 K(UBE2K)

Product Type : Recombinant Protein
Code : CSB-RP096674h
Size : Pls inquiry other sizes
Uniprot NO. : P61086
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1
Image :
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References : Regulation of macrophage-specific gene expression by degenerated lipoproteins.Furukawa Y., Kubo N., Kikuchi J., Tokura A., Fujita N., Sakurabayashi I.3.0.CO;2-9>Electrophoresis 21:338-346(2000)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : Huntingtin-interacting protein 2 ;HIP-2Ubiquitin carrier proteinUbiquitin-conjugating enzyme E2-25 kDa ;Ubiquitin-conjugating enzyme E2(25K) ;Ubiquitin-conjugating enzyme E2-25KUbiquitin-protein ligase
Species : Homo sapiens (Human)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Research Area : Neuroscience
Source : E.coli
Gene Names : UBE2K
Expression Region : 2-200aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 26.3kDa
Protein Description : Full Length
Contact us

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.