Recombinant Human Uncharacterized protein C1orf54 (C1orf54)

Code CSB-EP840992HU
Abbreviation C1orf54
MSDS
Size US$110
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
C1orf54
Uniprot No.
Research Area
Signal Transduction
Alternative Names
C1orf54Uncharacterized protein C1orf54
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
17-131aa
Target Protein Sequence
QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I ordered CSB-EP840992HU (see attached), and have the following questions.
I would like to have some precision about the buffer to recreate it for the control of my experiment.
Do you prepare
-10mM Tris-Hcl, 1mM (EDTA, pH8), 20% glycerol solution and then filter
-10mM Tris-HCL, 1mM EDTA and then you adjust to pH 8 and add 20% glycerol and filter?
-10mM Tris-Hcl, 1mM EDTA, 20% glycerol then adjust to pH 8 and filter?
Is it possible to filter with 20% Glycerol?”

A:
Thanks for your feedback. Buffer Preparation: 10mM Tris-HCL, 1mM EDTA and then we adjust to pH 8 and add 20% glycerol and filter.
It's Ok to filter with 20% glycerol, and 50% glycerol is also OK.

Target Background

Subcellular Location
Secreted.
Database Links

HGNC: 26258

KEGG: hsa:79630

UniGene: Hs.91283

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*