Home
Active Protein
Other
Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

^{In Stock}

Citations (1)

Code	CSB-MP025833HU(F4)
Abbreviation	Recombinant Human VEGFA protein (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human VEGFA protein at 2 μg/ml can bind Anti-VEGFA recombinant antibody (CSB-RA025833MA2HU). The EC₅₀ is 0.6797-0.8382 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/ml can bind Human VEGFA protein. The EC₅₀ is 28.72-33.22 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Citations
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human VEGFA protein at 2 μg/mL can bind Anti-VEGFA recombinant antibody (CSB-RA025833MA2HU). The EC50 is 0.6797-0.8382 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/mL can bind Human VEGFA protein. The EC50 is 28.72-33.22 ng/mL.

Target Names

VEGFA

Uniprot No.

P15692-4

Alternative Names

Vascular endothelial growth factor A, long form; L-VEGF; Vascular permeability factor (VPF); VEGFA; VEGF

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

27-191aa

Target Protein Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Mol. Weight

21.4 kDa

Protein Length

Full Length of Mature Protein of Isoform VEGF165

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.