Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP025810HU(A5) |
Size | $2062 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | VCAN |
Uniprot No. | P13611 |
Alternative Names |
Chondroitin sulfate proteoglycan 2; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan core protein; cartilage; CSPG2; CSPG2_HUMAN; ERVR; GHAP; Glial hyaluronate binding protein; Glial hyaluronate-binding protein; Large fibroblast proteoglycan; PG-M; PGM; VCAN; Versican; Versican core protein; Versican proteoglycan; WGN 1; WGN; WGN1
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 3089-3354aa |
Target Protein Sequence | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 47.6 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
|
Gene References into Functions |
|
Involvement in disease | Wagner vitreoretinopathy (WGVRP) |
Subcellular Location | Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix. |
Protein Families | Aggrecan/versican proteoglycan family |
Tissue Specificity | Expressed in the retina (at protein level). Cerebral white matter and plasma. Isoform V0: Expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V1: Expressed in normal brain, gliomas, medulloblastomas, |
Database Links |
HGNC: 2464 OMIM: 118661 KEGG: hsa:1462 STRING: 9606.ENSP00000265077 UniGene: Hs.643801 |