Recombinant Human Versican core protein (VCAN), partial

In Stock
Code CSB-EP025810HU(A5)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VCAN
Uniprot No.
Alternative Names
Chondroitin sulfate proteoglycan 2; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan core protein; cartilage; CSPG2; CSPG2_HUMAN; ERVR; GHAP; Glial hyaluronate binding protein; Glial hyaluronate-binding protein; Large fibroblast proteoglycan; PG-M; PGM; VCAN; Versican; Versican core protein; Versican proteoglycan; WGN 1; WGN; WGN1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3089-3354aa
Target Protein Sequence
GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
47.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Gene References into Functions
  1. VCAN expression in colorectal cancer and its role in cetuximab resistance PMID: 28320945
  2. miR-135a-5p can suppress cell progress including cell proliferation, migration, and invasion in thyroid carcinoma by targeting VCAN 3 '-UTR. PMID: 28869452
  3. This study highlights the oncogenic role of VCAN in renal cell carcinogenesis and suggests that this gene has therapeutic and/or biomarker potential for renal cell cancer. PMID: 28242813
  4. Interleukin-17A promotes tongue squamous cell carcinoma metastasis by activating miR-23b/versican pathway in the tumor microenvironment. PMID: 28035060
  5. The macular dysfunction on mfERG was profound and of early onset. A heterozygous mutation in intron 7 of the VCAN gene (c.4004-1G > A) was found. PMID: 29071374
  6. Versican V0 and V1 isoforms were upregulated in the uterine leiomyomas of symptomatic versus asymptomatic women. Abundant cleaved versican was detected in leiomyoma and myometrium, as well as in myometrial and leiomyoma cell lines. VCAN siRNA did not effect cell proliferation, apoptosis, or smooth muscle markers, but reduced ESR1 and PR-A expression. PMID: 28323982
  7. Lumican and versican protein expression are associated with colorectal adenoma-to-carcinoma progression PMID: 28481899
  8. Removal or knockdown of versican may be a possible therapeutic strategy for increasing deposition of insoluble elastin and stimulating repair of elastic fibers in COPD lung. PMID: 28138236
  9. human myeloma tumors displaying CD8(+) infiltration/aggregates underwent VCAN proteolysis at a site predicted to generate a glycosaminoglycan-bereft N-terminal fragment. PMID: 27259980
  10. versican decreases in follicular dermal papilla as an aging-associated change of human hair follicles PMID: 27697422
  11. Data indicate that serum versican levels were significantly decreased in polycystic ovary syndrome (PCOS) patients, and that serum ADAMTS-1 (a disintegrin and metalloproteinase with thrombospondin motif-1) and versican levels were significantly and positively correlated with each other. PMID: 27908842
  12. the G1 domain of versican can regulate the organization of pericellular hyaluronan and affect phenotype of cultured human dermal fibroblasts PMID: 27126822
  13. Results highlight an important role for versican in regulating the expression and assembly of elastin and the phenotype of leiomyosarcoma cells. PMID: 26723257
  14. Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division. PMID: 26395512
  15. VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC PMID: 26873137
  16. Versican is a novel modulator of hepatic fibrosis. PMID: 26752747
  17. versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia. PMID: 26057378
  18. Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts. PMID: 26176948
  19. Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy. PMID: 25915825
  20. Versican isoform V1 is associated with high-grade gliomas. PMID: 25064688
  21. Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma PMID: 25623955
  22. Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion. PMID: 25562163
  23. Circulating monocytes may contribute to the fibrotic process in a subset of systemic sclerosis patients by amplifying a positive feedback loop consisting of versican, CCL2, and the influx of monocytes PMID: 23845159
  24. Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681
  25. Versican regulates the growth of leiomyosarcoma tumors. PMID: 25320080
  26. these data suggest that versican regulates the development of peritoneal metastasis originating from cells and spheroids. PMID: 24999371
  27. The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis. PMID: 25122765
  28. Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients. PMID: 25275064
  29. Lack of versican expression is associated with recurrence in colon cancer. PMID: 22711178
  30. CD26 expression on T-anaplastic large cell lymphoma (ALCL) line Karpas 299 is associated with increased expression of versican and MT1-MMP and enhanced adhesion. PMID: 24180670
  31. FoxQ1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression. PMID: 24005989
  32. A novel c.4004-6T>A nucleotide substitution at the acceptor splice site of intron 7 of the VCAN gene that segregated with the Wagner disease phenotype, was identified. PMID: 24174867
  33. Cleaved versican G1 domain-containing fragments (VG1F) can be recaptured by microfibrils through VG1F homotypical interactions to enhance hyaluronan recruitment to microfibrils. PMID: 23963449
  34. altered balance of VCAN splice variants in combination with reduction in glycosaminoglycan protein modifications as pathogenic mechanisms in Wagner syndrome PMID: 22739342
  35. Letter/Case Report: disease causing versican mutation in Wagner syndrome. PMID: 23571384
  36. versican V1 enhances hCAP18/LL-37 expression in macrophages through activation of TLR2 and subsequent vitamin D-dependent mechanisms which promote ovarian tumor progression in vitro PMID: 23424670
  37. No association has been found between polymorphisms of rs251124 and rs3767137 loci of CSPG2 and HSPG2 genes and intracranial aneurysm in the selected population. PMID: 23568740
  38. Wnt/beta-catenin signal transducting system regulates dermal papilla cell aggregative growth through modifying versican expression by means of acting on the versican gene upstream promoter. PMID: 23099107
  39. these results demonstrate that versican V0 and V1 isoforms play important roles in HCC development and that versican mRNAs compete with endogenous RNAs in regulating miRNA functions. PMID: 23180826
  40. Mesenchymal cells derived from keloid lesion (KL) cells exhibit above-normal versican production. PMID: 22951719
  41. the glioblastoma cell line U87 stably transfected with versican isoform V2 formed tumors containing extensive vasculature PMID: 23201264
  42. renal versican expression was significantly upregulated as compared to corresponding controls. These data show for the first time an association of renal versican isoform V0 and V1 expression with progressive renal disease. PMID: 23024773
  43. Studies indicate that E-cadherin and versican are involved in cancer epithelial-mesenchymal transitions and metastasis. PMID: 23002209
  44. Tissue microarray analysis revealed that epithelial expression of versican had significant relations to lymph node metastasis and pathological stages of breast cancer PMID: 22318369
  45. E(2) treatment increases the amount of dermal HA and versican V2 via paracrine release of EGF, which may be implicated in the pro-proliferative and anti-inflammatory effects of E(2) during photoaging. PMID: 22493503
  46. The major isoforms expressed by gastric carcinoma & gastric cell lines were V0 & V1. V1 was higher in gastric carcinoma. Abnormally expressed versican & its isoforms participate in the progress of gastric carcinoma triggered by IL-11. PMID: 22393310
  47. RhoGDI2 suppresses lung metastasis in mouse models by reducing the expression of isoforms V1 and V3 of the proteoglycan versican, which is require for lung metastasis. High versican levels portended poor prognosis in patients with bladder cancer. PMID: 22406535
  48. Hyaluronan and versican play a role in T-cell trafficking and function in inflamed tissues. PMID: 22155153
  49. Versican is a key component of the provisional wound repair ECM that is expressed following injury to valvular interstitial cells. PMID: 21546273
  50. the G1 and G3 domains of versican were upregulated and LTBP-4 was downregulated in breast cancer stroma PMID: 21505857

Show More

Hide All

Involvement in disease
Wagner vitreoretinopathy (WGVRP)
Subcellular Location
Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix.
Protein Families
Aggrecan/versican proteoglycan family
Tissue Specificity
Expressed in the retina (at protein level). Cerebral white matter and plasma. Isoform V0: Expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V1: Expressed in normal brain, gliomas, medulloblastomas,
Database Links

HGNC: 2464

OMIM: 118661

KEGG: hsa:1462

STRING: 9606.ENSP00000265077

UniGene: Hs.643801

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*