Recombinant Human Vigilin (HDLBP), partial

In Stock
Code CSB-EP010257HU
Abbreviation Recombinant Human HDLBP protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HDLBP
Uniprot No.
Research Area
Cardiovascular
Alternative Names
High density lipoprotein-binding protein;HDL-binding protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1060-1268aa
Target Protein Sequence
DPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.1 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Appears to play a role in cell sterol metabolism. It may function to protect cells from over-accumulation of cholesterol.
Gene References into Functions
  1. Our data reveal that vigilin is essential for maintenance of imprinting of IGF2 gene via functional interaction between KH1-7 domains of vigilin and zinc-finger domains of CTCF. PMID: 29157910
  2. vigilin has been shown to bind over 700 mRNAs and has been associated with cancer progression and cardiovascular disease. PMID: 28975734
  3. this study shows that vigilin (HDLBP) binds and negatively regulates MICB expression through its 5'UTR, and that vigilin downregulation in target cells leads to NK cell activation against said target cells PMID: 28356383
  4. progressively upregulated vigilin may serve as a molecular risk marker for hepatocellular carcinoma development, and targeting vigilin may help to inhibit hepatocellular carcinoma cell growth, survival and migration. PMID: 24676454
  5. CTCF may regulate vigilin behavior and thus indirectly influence the binding of HP1alpha to the satellite 2 locus PMID: 24561205
  6. Vigilin may have a relationship with hepatocellular carcinoma progression and proliferation. PMID: 21500547
  7. identified a competition for binding the 69-nt sequence, through which vigilin and HuR exert opposing effects on c-fms expression, suggesting a role for vigilin in suppression of breast cancer progression PMID: 20974809
  8. Expression profiles of human VIGILIN, H19, and IGF2 mRNA increased with cell-cycle prograssion. PMID: 19950580
  9. RNA interference studies indicate vigilin is essential for cell viability but is not a global regulator of translation. PMID: 14500828
  10. evidence that vigilin is bound to the ribosomal complex. PMID: 15109574
  11. C-terminal domain of human vigilin binds to the histone methyltransferase SUV39H1 in vivo;a new model for vigilin-mediated, RNA-induced gene silencing is presented. PMID: 18648073

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Database Links

HGNC: 4857

OMIM: 142695

KEGG: hsa:3069

STRING: 9606.ENSP00000312042

UniGene: Hs.471851

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*