Recombinant Human X-ray repair cross-complementing protein 5(XRCC5),partial

Code CSB-EP026233HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names XRCC5
Uniprot No. P13010
Research Area Epigenetics and Nuclear Signaling
Alternative Names 86 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 2; ATP dependent DNA helicase II 80 kDa subunit; ATP dependent DNA helicase II 86 Kd subunit; ATP dependent DNA helicase II; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box binding factor 85 kDa; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; KARP 1; KARP1; Ku 80; Ku autoantigen 80kDa; Ku80; Ku86; Ku86 autoantigen related protein 1; KUB 2; KUB2; Lupus Ku autoantigen protein p86; NFIV; Nuclear factor IV; Thyroid lupus autoantigen; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining); X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X-ray repair cross-complementing protein 5; Xray repair complementing defective repair in Chinese hamster cells 5; XRCC 5; XRCC5; XRCC5_HUMAN
Species Homo sapiens (Human)
Source E.coli
Expression Region 251-455aa
Target Protein Sequence LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 27.4kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together
Gene References into Functions
  1. ATM-dependent phosphorylation of CtIP and the epistatic and coordinated actions of MRE11 and CtIP nuclease activities are required to limit the stable loading of Ku on single-ended DNA double-strand breaks. PMID: 27641979
  2. these results suggest that polymorphisms of XRCC5 play an important role in astrocytoma prognosis in the Chinese Han population which could be used in the determination of astrocytoma prognosis in clinical researches PMID: 27852033
  3. SAF-A, in concert with Ku, temporally regulates base damage repair in irradiated cell genome. PMID: 27303920
  4. High XRCC5 expresiion is associated with medullary thyroid carcinoma. PMID: 26870890
  5. Ku80 can be cleaved by caspases-2 at D726 upon a transient etoposide treatment. Caspase-2-mediated Ku80 cleavage promotes Ku80/DNA-PKcs interaction as the D726A mutation diminished Ku80 interaction with DNA-PKcs PMID: 29065392
  6. m-calpain translocated as the result of calcium influx was involved in DNA double-strand breaks repair, especially in the non-homologous end-joining pathway through proteolysis of nuclear Ku80. Cleaved Ku80 was still able to form a heterodimer with Ku70 and enhance DNA repair activity. PMID: 27121057
  7. Ku80 CTR (C-terminal region) is required for interaction with DNA-PKcs on short segments of blunt ended 25bp dsDNA or 25bp dsDNA with a 15-base poly dA ssDNA extension, but this requirement is less stringent on longer dsDNA molecules (35bp blunt ended dsDNA) or 25bp duplex DNA with either a 15-base poly dT or poly dC ssDNA extension. Moreover, DNA-PKcs-Ku complex forms on 25 bp DNA with poly-pyrimidine ssDNA extension. PMID: 28641126
  8. Ku80 could predict the probability of resistance to neoadjuvant chemotherapy in lung adenocarcinoma, and reduced cisplatin and pemetrexed-induced apoptosis in A549 cells PMID: 28399858
  9. results demonstrated that XRCC5 promoted colon cancer growth by cooperating with p300 to regulate COX-2 expression, and suggested that the XRCC5/p300/COX-2 signaling pathway was a potential target in the treatment of colon cancers PMID: 29049411
  10. Ku antigen displays the AP lyase activity on a certain type of double-stranded DNA. PMID: 27129632
  11. Results show that DDB2 is critical for chromatin association of XRCC5/6 in the absence of DNA damage and provide evidence that XRCC5/6 are functional partners of DDB2 in its transcriptional stimulatory activity. PMID: 28035050
  12. RNF126 is a novel regulator of NHEJ that promotes completion of DNA repair by ubiquitylating Ku80 and releasing Ku70/80 from damaged DNA. PMID: 27895153
  13. XRCC5 (rs1051685, rs6941) and AQP2 (10875989, rs3759125) polymorphisms were associated with hematologic toxicity of platinum-based chemotherapy in lung cancer patients PMID: 26358256
  14. Ku80 and PDGFR-alpha might be effective predictive indicators for the prognosis of nasal type NK/T cell lymphoma PMID: 26778387
  15. DNA methylation modification plays an important role to regulate the gene expression of XRCC5 and XRCC7, from the results that the gene methylation level of the glioma group is higher than that of the normal group PMID: 26464705
  16. Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability. PMID: 26359349
  17. The present study showed that the XRCC5 locus might be a contributor to COPD susceptibility in the Chinese Han population. PMID: 24615081
  18. Depletion of Ku80 in the lens through acute change or a consequence of aging is likely to increase levels of DNA strand breaks, which could negatively influence physiological function and promote lens opacity PMID: 26658510
  19. Data show that ubiquitin E3 ligase RNF138 regulates Ku80 antigen ubiquitylation in response to DNA damage. PMID: 26502055
  20. Polymorphisms in the Variable Number of Tandem Repeats at the promoter region of the XRCC5 is associated with gastric cancer. PMID: 25527410
  21. retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control PMID: 25818292
  22. Genome-wide gene-set-based analysis and follow-up studies in Drosophila and humans generated independent evidence for the involvement of XRCC5 (Ku80) in alcohol dependence PMID: 25035082
  23. Our data indicated that Ku80 expression level associates with key clinicopathological features and is an independent predictor of the OS and the DFS in pT2N0M0 ESCC patients. PMID: 25758053
  24. Polymorphism in XRCC5 gene is associated with Systemic Lupus Erythematosus. PMID: 25756210
  25. both the CG carriers/G allele carriers of rs2267437 (XRCC6) and the haplotype AT/CC established by the SNPs of XRCC5 are associated with ESCC (Esophageal Squamous Cell Carcinoma) susceptibility. PMID: 25702660
  26. the downregulation of Ku80 and an impairment of repair activity in squamous cells, which are mediated by miR-31. PMID: 25082302
  27. RECQL4 stimulates higher order DNA binding of Ku70/Ku80 to a blunt end DNA substrate. Taken together, these results implicate that RECQL4 participates in the NHEJ pathway of DSB repair via a functional interaction with the Ku70/Ku80 complex. PMID: 24942867
  28. High KU86 expression is associated with hepatocellular carcinoma. PMID: 24811221
  29. the VNTR polymorphism at the promoter region of XRCC5, but not XRCC6, may have a role in breast cancer risk or age at diagnosis of breast cancer PMID: 24615008
  30. down-regulation of Ku80 can sensitize ALT cells U2OS to radiation, and this radiosensitization is related to telomere length shortening. PMID: 23621240
  31. the VNTR polymorphism in the promoter region of XRCC5 gene could serve as an important prognostic marker in CML development. PMID: 23982877
  32. Ku86 staining in hepatocellular carcinoma was much stronger than in para-tumor and normal tissues. Expression of Ku86 was related to the tumor size, TNM stage, and tumor differentiation. Long-term survival of patients with low Ku86 expression was longer. PMID: 24271118
  33. Enhanced DNA-PKcs and Ku 70/80 expression may be closely associated with gastric carcinoma. PMID: 24187467
  34. The observations plead in favor of the hypothesis that Ku has an impact on HIV-1 expression and latency at early- and mid-time after integration. PMID: 23922776
  35. For XRCC4P and XRCC5P, only XRCC4P modified liver cancer risk. PMID: 23788213
  36. Processivity factor 8 (PF-8) of Kaposi's sarcoma-associated herpesvirus was identified as interacting with Ku70 and Ku86, and the interaction was dependent on DNA double-strand breaks and DNA. PMID: 23677788
  37. In systemic lupus spectrum diseases, anti-Ku are found associated with other autoantibodies; in systemic sclerosis anti-Ku are frequently associated with myositis and interstitial lung disease. PMID: 23910615
  38. This model highlights the importance of Ku70/80 oxidation which leads to increased Ku70/80 dissociation rates from DNA damage foci and shifts repair in favour of the less efficient Back-up-Non-Homologous End Joining system. PMID: 23457464
  39. The 3R allele of the VNTR polymorphism in the XRCC5 promoter region dramatically decreases the gene expression. PMID: 23220236
  40. Two (XRCC5 and TOP2A) of seven DNA repair and replication proteins studied were prognostic for melanoma. PMID: 23020778
  41. BRCA1-Ku80 protein interaction enhances end-joining fidelity of chromosomal double-strand breaks in the G1 phase of the cell cycle PMID: 23344954
  42. Ku80 expression level could predict the outcome and the sensitivity to cisplatin-based chemotherapy in patients with lung adenocarcinoma PMID: 23181744
  43. Results show the N-terminal region mediates the interaction between DNA-PKcs and the Ku70/Ku80-DNA complex and is required for its DNA double-stranded breaks (DSBs)-induced enzymatic activity. PMID: 23322783
  44. XRCC5 gene polymorphism is associated with breast cancer. PMID: 23098447
  45. It is suggested that the prevalence of the XRCC5 novel allele (3R allele) among European populations may be higher than its prevalence among Iranians. PMID: 23022196
  46. APLF promotes the assembly and activity of multi-protein Ku-DNA complexes containing all of the Non-homologous end joining (NHEJ) factors required for DNA ligation. PMID: 23178593
  47. Data indicate a significant positive association was found between female patients with anti-Ku p70 and joint/bone features, and a significant negative association was found between female patients with anti-Ku p80 only and joint/bone features. PMID: 22226402
  48. Data indicate that dynamic remodeling of the Ku complex coincided with exit of Ku and other DNA repair proteins from the nucleolus. PMID: 22535209
  49. study found Ku80 was downregulated in hepatocellular carcinoma(HCC) and Ku80 downregulation was correlated with elevated HBV-DNA load and liver cirrhosis; suggested an underlying mechanism in which Ku80 functions as a tumor suppressor in HCC by inducing S-phase arrest through a p53-dependent pathway PMID: 22226916
  50. Ku70/80 binds to DNA double strand breaks (DSB) in all cell cycle stages and is likely actively displaced from DSB ends to free the DNA ends for DNA end resection and thus homologous recombination to occur. PMID: 22265216
  51. Specificity of the dRP/AP lyase of Ku promotes nonhomologous end joining (NHEJ) fidelity at damaged ends PMID: 22362780
  52. The p21 C31A, Ku80 A2790G, and MDM2 T309G genetic polymorphic variations are associated with the occurrence of head and neck cancer in the Saudi Arabia population. PMID: 21877955
  53. findings provide further evidence that cytosolic XRCC5 has a key role in protection against DNA oxidation from Cu, through either direct sequestration or signaling through other Cu-detoxification molecules PMID: 21971347
  54. The authors find that RNF8 regulates the abundance of the nonhomologous end-joining (NHEJ) repair protein KU80 at sites of DNA damage. PMID: 22266820
  55. Lung carcinoma tissue had higher Ku80 mRNA & protein levels than normal tissue. Lung adenocarcinoma & lung squamous carcinoma had higher levels of Ku80 protein & mRNA, than small-cell lung carcinoma. PMID: 21663524
  56. these results support that FAM13A rs2869967 and XRCC5 rs3821104 are associated with COPD in Chinese Han population. PMID: 22027142
  57. The function of KARP-1 could not perfectly replace that of Ku80 in DSB repair, although KARP-1 has some biochemical properties, which resemble those of Ku80, and also works as a heterodimer with Ku70. KARP-1 may have a novel role in DSB response. PMID: 21756904
  58. We suggest that air pollution by c-PAHs affects XRCC5 gene expression PMID: 21684294
  59. Data show that shRNA-mediated knockdown of the Ku70/80 heterodimer inhibits ALT cell growth and results in a significant decrease in the levels of t-circles without affecting overall telomere length. PMID: 21512205
  60. Data suggest that the T allele of Ku80 G-1401T may be associated with the development of gastric cancer. PMID: 21547134
  61. Ku70 may interact with IN during viral assembly and accompany HIV-1 IN upon entry into the new target cells, acting to 1) protect IN from the host defense system and 2) assist IN integration activity. PMID: 21454661
  62. the studies investigating the association between the XRCC5/XRCC6 dimer and the susceptibility to multiple cancers and discuss its role in carcinogenesis and its potential application to anticancer drug discovery were summarized. PMID: 21521024
  63. Ku80 overexpression was an independent predictor for both locoregional failure and mortality following radiotherapy in heand and neck cancers PMID: 21349997
  64. single nucleotide polymorphisms in XRCC5 and XRCC6 may play a role in determination of individual susceptibility profile to hepatocellular carcinoma. PMID: 21304054
  65. In this study, we modelled the full-length Ku heterodimer from the truncated crystal structure and NMR structure. PMID: 21196465
  66. Studies indicated that DDX21, HNRNPC, and RCC2 were isolated from Ku86 multicomponent complex in response to DNA damage. PMID: 20873769
  67. Data show that the heterodimeric domain of Ku was sufficient for the recruitment of XLF to DSBs and for the interaction of Ku with XLF. PMID: 21349273
  68. data allowed the identification of Ku86 as a new player involved in metastasis in breast cancer cells. PMID: 21137076
  69. This study also reveals that the interaction between Zta and Ku80 involves the C-terminal region of Zta and the 425 aa N-terminal region of Ku80. PMID: 21123545
  70. characterized a radiosensitive phenotype due to reduced levels of the Ku70 and Ku80 DNA repair proteins PMID: 21116096
  71. The role of Ku80 enhances TRF2 chromatin association and that non-chromatin bound TRF2 is targeted to the proteasome. PMID: 20890109
  72. Different roles of DNA-PKcs and Ku70/80 in repair and cell death regulation after DNA damage. PMID: 21042724
  73. coilin interacts with Ku70 and Ku80 PMID: 21070772
  74. XRCC5 on chromosome 2q was identified, in addition to SERPINE2, as a COPD susceptibility gene, combining results of 2 case-control and 2 family -based studies. PMID: 20463177
  75. Ku80 is susceptible to proteolytic degradation when not dimerized with Ku70; dimer induces DNA-PK activity; evidence that interacting domain(s) of Xenopus DNA-PKcs is conserved so as to interact with human Ku, reconstituting a functional holoenzyme PMID: 20047046
  76. Ku70 and Ku80 proteins in interaction with AP-2 (alpha and gamma) contribute to increased ERBB2 mRNA and protein levels in breast cancer cells. PMID: 19906305
  77. Ku is the critical classic non-homologous end joining (NHEJ) factor that regulates DNA NHEJ DNA double-strand break pathway choice. PMID: 20195511
  78. The T allele of Ku80 G-1401T may be associated with the development of breast cancer. PMID: 20044645
  79. Ku and DNA-dependent protein kinase dynamic conformations and assembly regulate DNA binding and the initial non-homologous end joining complex. PMID: 19893054
  80. Data show that DSB promote PP2A to associate with Ku 70 and Ku 86. PMID: 19794960
  81. transcription initiates from a CpG island and is induced by p53 through a nearby p53 response element PMID: 11937624
  82. Ku80 alteration is unlikely to be involved in multiple myeloma PMID: 11985783
  83. Expression of Ku70/Ku80 proteins is decreased in malignant melanomas of the oral cavity. PMID: 12017286
  84. Association of DNA polymerase mu (pol mu) with Ku and ligase IV: role for pol mu in end-joining double-strand break repair. PMID: 12077346
  85. role of expression in NF-kappaB activation and COX-2 expression PMID: 12324457
  86. Ku associates with hTERT, and this interaction may function to regulate the access of telomerase to telomeric DNA ends PMID: 12377759
  87. These results suggest that association of Ku with transcription sites is important for maintenance of global transcription levels. PMID: 12391174
  88. The expression of Ku is upregulated in human neuroectodermal tumor cells by retroviral DNA integration PMID: 12403924
  89. Transcripts of Ku70 and Ku86 genes were detected by RT-PCR and Ku protein was localized in the nucleus of neutrophils as a heterodimer PMID: 12467650
  90. The mechanism that regulates for nuclear localization of Ku70 and Ku80 appears to play, at least in part, a key role in regulating the physiological function of Ku in vivo. PMID: 12518983
  91. DNA repair proteins Ku70 and Ku80 expression is lost in cell nucleus after oxidative stress PMID: 12867423
  92. binding of the Ku complex at chromosomal breaks may be necessary to maintain the sliding clamps (PCNA) on chromatin PMID: 14617623
  93. Results show that Ku70/Ku80 and DNA-dependent protein kinase catalytic subunit (DNA-PKcs) modulate RAG-mediated cleavage during V(D)J recombination. PMID: 15123719
  94. DNA-binding component of human OF-1 (which binds Herpes simplex virus type 1 origin of replication) contains Ku70 and Ku80 proteins PMID: 15220460
  95. DNA degradation diminished the amount of Ku70 associated with gamma-H2AX but not that of nuclear DNA helicase II. PMID: 15613478
  96. Ku is involved in transcriptional recycling with androgen dependent promoters PMID: 15640154
  97. Ku70-binding site of Ku80 is required for the stabilization of Ku70 in the cytoplasm and for the nuclear translocation of Ku80 through its heterodimerization with Ku70. PMID: 15817152
  98. Ku70/80 interacts directly with the RNA component of human telomerase, independent of the human telomerase reverse transcriptase protein. PMID: 15824061
  99. Study using HCT116 haplo-insufficient cells and Orc2 hypomorphic cells demonstrates that human Ku80 and Orc2 bind to replication origins independently of each other, while Ku binding precedes that of Orc-3, -4, and -6. PMID: 15910003
  100. findings suggest Ku80 as a cellular factor targeted by Tax in engendering clastogenic DNA damage. PMID: 16014171

Show More

Hide All

Subcellular Location Nucleus, Nucleus, nucleolus, Chromosome
Protein Families Ku80 family
Database Links

HGNC: 12833

OMIM: 194364

KEGG: hsa:7520

STRING: 9606.ENSP00000375977

UniGene: Hs.388739

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1