Recombinant Human YEATS domain-containing protein 4(YEATS4)

Code CSB-EP026252HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O95619
Relevance Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Glioma-amplified sequence 41
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names YEATS4
Protein Names Recommended name: YEATS domain-containing protein 4 Alternative name(s): Glioma-amplified sequence 41 Short name= Gas41 NuMA-binding protein 1 Short name= NuBI-1 Short name= NuBI1
Expression Region 1-227aa
Tag Info N-terminal GST-tagged
Mol. Weight 53.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Subcellular Location Nucleus
Tissue Specificity Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Database Links

HGNC: 24859

OMIM: 602116

KEGG: hsa:8089

STRING: 9606.ENSP00000247843

UniGene: Hs.4029

Related Products

YEATS4 Antibodies

YEATS4 Antibodies for Homo sapiens (Human)

YEATS4 Antibodies for Human

YEATS4 Proteins

YEATS4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.