Recombinant Human Zinc transporter ZIP1 (SLC39A1), partial

In Stock
Code CSB-EP885760HU
Abbreviation Recombinant Human SLC39A1 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SLC39A1
Uniprot No.
Research Area
Transport
Alternative Names
hZIP1; IRT1; S39A1_HUMAN; SLC39A1; Solute carrier family 39 member 1; Zinc transporter ZIP1; Zinc-iron-regulated transporter-like; ZIP-1; ZIP1; ZIRTL; Zrt- and Irt-like protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
126-179aa
Target Protein Sequence
MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.1kDa
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
Gene References into Functions
  1. Despite the fact that these preliminary findings are unlikely to be of much diagnostic significance, these findings suggest that hZip1 plays a fundamental role in the carcinogenesis of mucinous tumors. PMID: 26081940
  2. Data indicate that zinc transporters ZnT1 and Zip1 were the most abundantly expressed zinc transporters in leukocytes. PMID: 24488210
  3. Data suggest that high zrt- and Irt-like protein 1 (hZIP1) expression may be an indicator of good prognosis in clear cell renal cell carcinoma (ccRCC). PMID: 24878177
  4. The effect of zinc administered for 27 days on the expression of ZIP1 in peripheral white blood cells is reported. PMID: 24922175
  5. RREB-1 overexpression results in down-regulation of hZIP1 and contributes to the loss of hZIP1 expression and zinc in prostate cancer. PMID: 21360563
  6. Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls. PMID: 23921484
  7. Data indicate that the expression levels of ZnT and ZIP families in the three cell lines, when treated with high concentration of ZnSO4, increased and decreased corresponding to their functions, respectively. PMID: 23839533
  8. The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease. PMID: 22349685
  9. The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients. PMID: 21053094
  10. Differentiated Caco-2 cells tolerate significantly higher levels of zinc compared to undifferentiated Caco-2 cells, which was accompanied by upregulated ZnT-1 and downregulated ZIP1 levels. PMID: 21103883
  11. GSPE and EGCG enhance the expression of cellular zinc importers ZIP1 (SLC39A1). PMID: 20471814
  12. the expression of human Zn transporter1 (hZIP1) appears to correlate with the Zn levels in the prostate glands and may be the major Zn regulator in this organ. PMID: 20705137
  13. Ras pathway and activation of RREB-1 are involved in hZIP1 down-regulation and may play a role in the decrease of the transporter expression in prostate cancer. PMID: 19802870
  14. zip1 mechanism of transport appears to involve the transport of zinc from low molecular weight ligands that exist in circulation as relatively loosely bound complexes with zinc PMID: 12888280
  15. ZIP1, ZIP2 and ZIP3 may play cell-specific roles in zinc homeostasis rather than primary roles in the acquisition of dietary zinc PMID: 14525987
  16. down regulation of hZIP1 is a critical early event in the development prostate cancer PMID: 16153295
  17. In conclusion, these studies provide important insights into the role of a plasma membrane zinc transporter (ZIP1) in the initiation of an osteogenic lineage from MSCs. PMID: 16203195
  18. di-leucine sorting signal of ZIP1 was required and sufficient for endocytosis of the chimeric proteins PMID: 17635580
  19. Gene expression regulation of ZIPs after zinc supplementation. PMID: 18279033
  20. results show that hZIP1 overexpression has a functional effect on the malignant potential of prostate cancer cells via inhibition of NF-kappaB-dependent pathways and support the concept that hZIP1 may function as a tumor suppressor gene PMID: 18765529
  21. The core promoter region responsible for constitutive expression of hZip1 were identified and critical roles for SP1 and CREB1 in transcriptional regulation of the hZip1 gene in prostate cancer cells, was demonstrated. PMID: 19026724
  22. ZIP is a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis PMID: 19644445

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Shows a vesicular localization corresponding partially to the endoplasmic reticulum in several epithelial cell lines.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Ubiquitous. Expressed in most adult and fetal tissues including the epidermis.
Database Links

HGNC: 12876

OMIM: 604740

KEGG: hsa:27173

STRING: 9606.ENSP00000309710

UniGene: Hs.743291

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*