Home
Protein
Recombinant Proteins
Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)

Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)

^{In Stock}

Code	CSB-YP2069HIZ
Abbreviation	Recombinant Human cytomegalovirus egfp protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

egfp

Uniprot No.

C5MKY7

Research Area

Microbiology

Source

Yeast

Expression Region

1-239aa

Target Protein Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.9kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Expand your microbiology research capabilities with our high-quality Recombinant Human Cytomegalovirus EGFP protein. This enhanced green fluorescent protein (EGFP) derived from Human cytomegalovirus (HHV-5) is an invaluable tool for visualizing cellular and viral processes, as well as monitoring gene expression and protein localization.

The full-length Recombinant Human Cytomegalovirus EGFP protein, expressed in yeast, encompasses the 1-239aa expression region, ensuring a robust and reliable performance in your experiments. Featuring both N-terminal 10xHis and C-terminal Myc tags, this protein can be efficiently purified and detected for precise results. With a purity of greater than 90% as determined by SDS-PAGE, our EGFP protein delivers consistent and dependable outcomes for your research needs. Available in both liquid and lyophilized powder forms, this versatile protein is ideal for a variety of experimental setups.