Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

In Stock
Code CSB-EP366164HWY
Abbreviation Recombinant Human herpesvirus 1 US11 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
US11
Uniprot No.
Research Area
Others
Alternative Names
US11; Accessory factor US11; Vmw21
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Source
E.coli
Expression Region
1-161aa
Target Protein Sequence
MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.
Gene References into Functions
  1. Nucleophosmin Interactions with Human Immunodeficiency Virus Rev and Herpes Simplex Virus US11 PMID: 26624888
  2. Herpes simplex virus 1 Us11 suppresses host interferon beta1 production through the inhibition of the PACT. PMID: 24067967
  3. Herpes simplex virus type 1 virion-derived US11 inhibits type 1 interferon-induced protein kinase R phosphorylation. PMID: 23773021
  4. PKR expression and the PKR binding domain of herpes simplex virus 1 Us11 are required for the antiautophagic activity of Us11. PMID: 23115300
  5. HSV-1 US11 binds to RIG-I and MDA-5 and inhibits their downstream signaling pathway. PMID: 22301138
  6. found an increase in the nucleolar accumulation of US11 in nucleolin-depleted cells, thereby revealing that nucleolin could play a role in US11 nucleocytoplasmic trafficking through one-way directional transport out of the nucleolus PMID: 22130536
  7. By constructing a series of deletion mutants fused with enhanced yellow fluorescent protein, three novel nucleolar localization signals of US11 were for the first time mapped to amino acids 84-125, 126-152, and 89-146, respectively. PMID: 20633584
  8. The binding site of the RNA-binding domain of US11 to RNA was characterized. PMID: 16246910
  9. herpes simplex virus type 1 Us11 gene product is able to counteract the activity of 2'-5' oligoadenylate synthetase, a third cellular protein critical for host defense PMID: 17229694
  10. The results favor an anti-apoptotic activity of US11 polypeptide that appears to be located at the level of mitochondria or upstream signaling pathways. PMID: 18395766

Show More

Hide All

Subcellular Location
Host nucleus, host nucleolus. Host cytoplasm. Note=Following infection, it is released into the cell cytoplasm.
Protein Families
Simplex virus US11 protein family
Database Links

KEGG: vg:2703439

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*