Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

US11

Uniprot No.

P04487

Research Area

Others

Alternative Names

US11; Accessory factor US11; Vmw21

Species

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Source

E.coli

Expression Region

1-161aa

Target Protein Sequence

MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.2 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.

Gene References into Functions

Nucleophosmin Interactions with Human Immunodeficiency Virus Rev and Herpes Simplex Virus US11 PMID: 26624888
Herpes simplex virus 1 Us11 suppresses host interferon beta1 production through the inhibition of the PACT. PMID: 24067967
Herpes simplex virus type 1 virion-derived US11 inhibits type 1 interferon-induced protein kinase R phosphorylation. PMID: 23773021
PKR expression and the PKR binding domain of herpes simplex virus 1 Us11 are required for the antiautophagic activity of Us11. PMID: 23115300
HSV-1 US11 binds to RIG-I and MDA-5 and inhibits their downstream signaling pathway. PMID: 22301138
found an increase in the nucleolar accumulation of US11 in nucleolin-depleted cells, thereby revealing that nucleolin could play a role in US11 nucleocytoplasmic trafficking through one-way directional transport out of the nucleolus PMID: 22130536
By constructing a series of deletion mutants fused with enhanced yellow fluorescent protein, three novel nucleolar localization signals of US11 were for the first time mapped to amino acids 84-125, 126-152, and 89-146, respectively. PMID: 20633584
The binding site of the RNA-binding domain of US11 to RNA was characterized. PMID: 16246910
herpes simplex virus type 1 Us11 gene product is able to counteract the activity of 2'-5' oligoadenylate synthetase, a third cellular protein critical for host defense PMID: 17229694
The results favor an anti-apoptotic activity of US11 polypeptide that appears to be located at the level of mitochondria or upstream signaling pathways. PMID: 18395766

Hide All

Subcellular Location

Host nucleus, host nucleolus. Host cytoplasm. Note=Following infection, it is released into the cell cytoplasm.

Protein Families

Simplex virus US11 protein family

Database Links

KEGG: vg:2703439

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP366164HWY
Abbreviation	Recombinant Human herpesvirus 1 US11 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage