Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
gD; US6; Envelope glycoprotein D; gD
Species
Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)
Expression Region
26-340aa
Target Protein Sequence
KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
In e.coli cells, the generation of the recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D includes integrating a DNA fragment encoding the Human herpesvirus 1 (strain KOS) Envelope glycoprotein D (26-340aa) into a plasmid vector and transforming this vector into e.coli cells. Cells containing the plasmid are screened, cultured, and induced to yield the Envelope glycoprotein D. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Lysis of the cells facilitates the collection of the recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D, which is subjected to affinity purification and then SDS-PAGE analysis and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D is greater than 85%.
