Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Species
Human papillomavirus type 16
Target Protein Sequence
MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression of the recombinant Human papillomavirus type 16 Protein E4 involves the construction of a plasmid encoding the Human papillomavirus type 16 Protein E4 (1-92aa). This resulting plasmid is introduced into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. The protein is fused with a N-terminal 10xHis tag and C-terminal Myc tag. After that, cultured cells are lysed. The subsequent step includes purifying the recombinant Human papillomavirus type 16 Protein E4 through affinity purification from the cell lysate and assessing the purity of the protein via SDS-PAGE. The purity of the recombinant Protein E4 is greater than 85%.
