| Code | CSB-YP362073HQD |
| Abbreviation | Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial |
| MSDS | |
| Size | $250 |
| Order now | |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I have a question about item CSB-YP362073HQD Recombinant Human rhinovirus A serotype 89 Genome polyprotein. I ask if there is a cleavage site that will allow removal of the His-tag from the recombinant protein.
Would you have this information available that you could share?
NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV