Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial

Code CSB-YP362073HQD
Product Type Recombinant Protein
Size US$2010
Uniprot No. P07210
Relevance Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host mbrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks .Capsid protein VP2: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome .Capsid protein VP3: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome .Capsid protein VP4: Lies on the inner surface of the capsid shell. After binding to the host receptor, the capsid undergoes conformational changes. Capsid protein VP4 is released, Capsid protein VP1 N-terminus is externalized, and together, they shape a pore in the host mbrane through which the viral genome is translocated into the host cell cytoplasm. After genome has been released, the channel shrinks .Capsid protein VP0: Component of immature procapsids, which is cleaved into capsid proteins VP4 and VP2 after maturation. Allows the capsid to rain inactive before the maturation step .Protein 2A: Cysteine protease that cleaves viral polyprotein and specific host proteins. It is responsible for the cleavage between the P1 and P2 regions, first cleavage occurring in the polyprotein. Cleaves also the host translation initiation factor EIF4G1, in order to shut down the capped cellular mRNA translation. Inhibits the host nucleus-cytoplasm protein and RNA trafficking by cleaving host mbers of the nuclear pores .Protein 2B: Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca2+ in the cytoplasm of infected cell. In turn, high levels of cyctoplasmic calcium may trigger mbrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication .Protein 2C: Induces and associates with structural rearrangents of intracellular mbranes. Displays RNA-binding, nucleotide binding and NTPase activities. May play a role in virion morphogenesis and viral RNA encapsidation by interacting with the capsid protein VP3 .Protein 3AB: Localizes the viral replication complex to the surface of mbranous vesicles. Together with protein 3CD binds the Cis-Active RNA Elent (CRE) which is involved in RNA synthesis initiation. Acts as a cofactor to stimulate the activity of 3D polymerase, maybe through a nucleid acid chaperone activity .Protein 3A: Localizes the viral replication complex to the surface of mbranous vesicles. It inhibits host cell endoplasmic reticulum-to-Golgi apparatus transport and causes the dissassbly of the Golgi complex, possibly through GBF1 interaction. This would result in depletion of MHC, trail receptors and IFN receptors at the host cell surface .Viral protein genome-linked: acts as a primer for viral RNA replication and rains covalently bound to viral genomic RNA. VPg is uridylylated prior to priming replication into VPg-pUpU. The oriI viral genomic sequence may act as a tplate for this. The VPg-pUpU is then used as primer on the genomic RNA poly(A) by the RNA-dependent RNA polymerase to replicate the viral genome. VPg may be roved in the cytoplasm by an unknown enzyme termed "unlinkase". VPg is not cleaved off virion genomes because replicated genomic RNA are encapsidated at the site of replication .Protein 3CD: Is involved in the viral replication complex and viral polypeptide maturation. It exhibits protease activity with a specificity and catalytic efficiency that is different from protease 3C. Protein 3CD lacks polymerase activity. The 3C domain in the context of protein 3CD may have an RNA binding activity .Protease 3C: cleaves host DDX58/RIG-I and thus contributes to the inhibition of type I interferon production. Cleaves also host PABPC1 .RNA-directed RNA polymerase: Replicates the viral genomic RNA on the surface of intracellular mbranes. May form linear arrays of subunits that propagate along a strong head-to-tail interaction called interface-I. Covalently attaches UMP to a tyrosine of VPg, which is used to prime RNA synthesis. The positive stranded RNA genome is first replicated at virus induced mbranous vesicles, creating a dsRNA genomic replication form. This dsRNA is then used as tplate to synthesize positive stranded RNA genomes. ss+RNA genomes are either translated, replicated or encapsidated ..
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP362073HQD could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) N/A.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP362073HQD could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) N/A.
Storage Buffer Tris-based buffer,50% glycerol
Species Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
Research Area Others
Source Yeast
Protein Names Recommended name: Genome polyproteinCleaved into the following 12 chains: 1. Protein VP0Alternative name(s): VP4-VP2 Protein VP4Alternative name(s): P1A Virion protein 4 Protein VP2Alternative name(s): P1B Virion protein 2 Pr
Expression Region 575-866aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 34.6 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Capsid protein VP1
Subcellular Location Capsid protein VP0: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP4: Virion, SUBCELLULAR LOCATION: Capsid protein VP2: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP3: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP1: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protein 2B: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 2C: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3A: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3AB: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Viral protein genome-linked: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protease 3C: Host cytoplasm, SUBCELLULAR LOCATION: Protein 3CD: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Picornaviruses polyprotein family

Q&A and Customer Reviews

Q&A
Q:

I have a question about item CSB-YP362073HQD Recombinant Human rhinovirus A serotype 89 Genome polyprotein. I ask if there is a cleavage site that will allow removal of the His-tag from the recombinant protein.
Would you have this information available that you could share?

A:
Very nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-YP362073HQD
Name: Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial
Expression Region: 575-866aa, Partial
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV


You have purchased 4mg of this protein with N-terminal 6xHis-tagged on November 20th, 2017 in P-76058.
This protein has NO cleavage site currently, so we can't remove His-tag by enzyme digestion.
If you would like to remove the His-tag, we could redesign primer, add restriction site, re-perform subcloning and provide no-tagged protein (The expression region and sequence won't change.)
Customer Reviews

Related Products

Antibodies

Antibodies for Human rhinovirus A serotype 89

Proteins

Proteins for Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.