Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial

Code CSB-EP362073HQD
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07210
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
Source E.coli
Expression Region 575-866aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 48.6 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Capsid protein VP1
Subcellular Location Capsid protein VP0: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP4: Virion, SUBCELLULAR LOCATION: Capsid protein VP2: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP3: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP1: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protein 2B: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 2C: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3A: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3AB: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Viral protein genome-linked: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protease 3C: Host cytoplasm, SUBCELLULAR LOCATION: Protein 3CD: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Picornaviruses polyprotein family

Related Products

Antibodies

Antibodies for Human rhinovirus A serotype 89

Proteins

Proteins for Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.