Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial

Product Type Recombinant Protein
Uniprot No. P07210
Species Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
Research Area Others
Protein Names Recommended name: Genome polyproteinCleaved into the following 12 chains: 1. Protein VP0Alternative name(s): VP4-VP2 Protein VP4Alternative name(s): P1A Virion protein 4 Protein VP2Alternative name(s): P1B Virion protein 2 Pr
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Capsid protein VP1
Subcellular Location Capsid protein VP0: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP4: Virion, SUBCELLULAR LOCATION: Capsid protein VP2: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP3: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP1: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protein 2B: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 2C: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3A: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3AB: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Viral protein genome-linked: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protease 3C: Host cytoplasm, SUBCELLULAR LOCATION: Protein 3CD: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Picornaviruses polyprotein family

Product Details for Different Expression Systems

Product Name Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial,Baculovirus
Code CSB-BP362073HQD
Size Pls inquiry other sizes
Source Baculovirus
Purity Greater than 85% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
Expression Region 575-866aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human rhinovirus A serotype 89 Genome polyprotein,partial,Mammalian cell
Code CSB-MP362073HQD
Size Pls inquiry other sizes
Source Mammalian cell
Purity Greater than 85% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
Expression Region 575-866aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.