Recombinant Hypocrea jecorina Hydrophobin-2(hfb2)

Code CSB-EP304437HYEb0
Product Type Recombinant Protein
Size US$2466
Uniprot No. P79073
Relevance Responsible for spore hydrophobicity and protection.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hydrophobin II
Species Hypocrea jecorina (Trichoderma reesei)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Research Area others
Source E.coli
Gene Names hfb2
Expression Region 16-86aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 10.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for spore hydrophobicity and protection.
Subcellular Location Spore wall, Secreted, cell wall
Protein Families Cerato-ulmin hydrophobin family

Related Products

hfb2 Antibodies

hfb2 Antibodies for Hypocrea jecorina (Trichoderma reesei)

hfb2 Proteins

hfb2 Proteins for Hypocrea jecorina (Trichoderma reesei)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.