Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

OmpK36

Uniprot No.

D6QLY3

Research Area

Others

Alternative Names

(Outer membrane protein C)(Phosphoporin PhoE)(Porin OmpK36)

Species

Klebsiella pneumoniae

Source

E.coli

Expression Region

22-372aa

Target Protein Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Klebsiella pneumoniae OmpK36 was expressed with the amino acid range of 22-372. This OmpK36 protein is theoretically predicted to have a molecular weight of 42.8 kDa. Expression of this OmpK36 protein is conducted in e.coli. The OmpK36 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant OmpK36 protein in following stages of expression and purification.

Klebsiella pneumoniae OmpK36 is a crucial component of the bacterial outer membrane, functioning as a pore-forming protein that facilitates the transport of various molecules across the membrane. It plays a role in the permeability of the outer membrane, allowing the passage of ions and small molecules. OmpK36 is particularly important in the context of antibiotic resistance, as alterations in its structure can contribute to reduced membrane permeability, affecting the efficacy of antibiotics. Understanding the properties and functions of OmpK36 is essential for developing strategies to combat antibiotic resistance in Klebsiella pneumoniae infections.

Code	CSB-EP3608KBGa0
Abbreviation	Recombinant Klebsiella pneumoniae OmpK36 protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Klebsiella pneumoniae OmpK36 (OmpK36)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage