Home
Protein
Recombinant Proteins
Recombinant Klebsiella pneumoniae Outer membrane protein A (ompA), partial

Recombinant Klebsiella pneumoniae Outer membrane protein A (ompA), partial

^{In Stock}

Code	CSB-EP340587KBG
Abbreviation	Recombinant Klebsiella pneumoniae ompA protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ompA

Uniprot No.

P24017

Research Area

Microbiology

Alternative Names

ompA; Outer membrane protein A; Outer membrane porin A; Outer membrane protein 3A

Species

Klebsiella pneumoniae

Source

E.coli

Expression Region

190-344aa

Target Protein Sequence

GQEDAAPVVAPAPAPAPEVATKHFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEAYNQQLSEKRAQSVVDYLVAKGIPAGKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKEVVTQPQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.0 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Would you expect the E. coli expression to be sufficient for as “native” as possible structure?

We can only express the supernatant as close as possible to the natural protein of prokaryotic species, but we can't detect the specific structure.
Except the supernatant protein, CSB-EP340587KBG, is in stock, the other two proteins are semi-custom products, and the insertion of corresponding labels and restriction sites can be determined according to customer needs.

Will there be any cleavage sequences inserted between the target sequence and the tag for tag-removal to be attempted?

For CSB-EP340587KBG, there is no Restriction Enzyme cutting site was added to the C-terminal, so the tag could not be removed.

Target Background

Function

With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm. Acts as a porin with low permeability that allows slow penetration of small solutes; an internal gate slows down solute passage.; Required for conjugation with F-type plasmids; probably serves as the mating receptor on recipient cells.

Subcellular Location

Cell outer membrane; Multi-pass membrane protein.

Protein Families

OmpA family

Promotions