Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51 (FCGRT), partial

Code CSB-EP851443MOV
Abbreviation Recombinant Cynomolgus monkey FCGRT protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
FCGRT; FCRNIgG receptor FcRn large subunit p51; FcRn; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
E.coli
Expression Region
24-297aa
Target Protein Sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.4kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To create the recombinant Macaca fascicularis FCGRT protein, we use genetic engineering techniques to insert a gene fragment that encodes the 24-297aa of Macaca fascicularis FCGRT into E.coli through a plasmid. The N-terminal 6xHis-SUMO-tag gene is also cloned into the plasmid. The E.coli serves as a factory for producing the recombinant FCGRT protein using its cellular machinery. The resulting products undergo affinity chromatography purification, reaching a purity of over 90% as measured by SDS-PAGE.

The FcGRT protein is a critical component of the neonatal Fc receptor (FcRn), which is significant in regulating immunoglobulin G (IgG) and albumin levels in the bloodstream. It is structurally similar to MHC class I molecules and is essential for IgG recycling, extending its half-life in circulation. The FCGRT gene is located on chromosome 19q13.35 and exhibits polymorphisms that can influence the expression levels of the FcRn protein, which in turn affects immune responses and susceptibility to various diseases, including autoimmune disorders and cancers [1][2][3].

FcGRT functions primarily by binding to IgG in acidic endosomal compartments, allowing for the recycling of IgG back to the extracellular space, which prevents its degradation in lysosomes [4][5]. This mechanism is important in maintaining IgG levels during immune responses, as it allows for the sustained presence of antibodies in circulation, which is crucial for effective immune surveillance and response [6]. Increased expression of FcGRT has been associated with certain cancers, such as glioma, where it mediates the malignant phenotype by prolonging IgG half-life and enhancing immune evasion [4].

References:
[1] Z. Zhang, Rescue treatment with add-on efgartigimod in a patient with impending myasthenic crisis: a case report, Therapeutic Advances in Neurological Disorders, vol. 17, 2024. https://doi.org/10.1177/17562864241254895
[2] A. Fisse, Association of the neonatal fc receptor promoter variable number of tandem repeat polymorphism with immunoglobulin response in patients with chronic inflammatory demyelinating polyneuropathy, European Journal of Neurology, vol. 31, no. 4, 2024. https://doi.org/10.1111/ene.16205
[3] M. Dalakas and P. Spaeth, The importance of fcrn in neuro-immunotherapies: from igg catabolism, fcgrt gene polymorphisms, ivig dosing and efficiency to specific fcrn inhibitors, Therapeutic Advances in Neurological Disorders, vol. 14, p. 175628642199738, 2021. https://doi.org/10.1177/1756286421997381
[4] G. Wang, Z. Wang, T. Ma, J. Pan, H. Ge, T. Yanet al., Fcgrt, a cancer-derived immunoglobulin g binding protein, mediates the malignant phenotype of glioma,, 2023. https://doi.org/10.21203/rs.3.rs-3217723/v1
[5] M. Babamohamadi, Anti-ctla-4 nanobody as a promising approach in cancer immunotherapy, Cell Death and Disease, vol. 15, no. 1, 2024. https://doi.org/10.1038/s41419-023-06391-x
[6] M. Pyzik, L. Kozicky, A. Gandhi, & R. Blumberg, The therapeutic age of the neonatal fc receptor, Nature Reviews Immunology, vol. 23, no. 7, p. 415-432, 2023. https://doi.org/10.1038/s41577-022-00821-1

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation. In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB.
Gene References into Functions
  1. None of the non-synonymous variants of FCGRT or B2M found changes in the amino acid residues known to be important for FcRn function, suggesting that substantial inter-animal variability of FcRn is not expected for the cynomolgus macaques analyzed PMID: 24806819
  2. Characterization and screening of IgG binding to the neonatal Fc receptor. PMID: 24802048
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endosome membrane.
Protein Families
Immunoglobulin superfamily
Database Links

KEGG: mcf:102128913

UniGene: Mfa.8387

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*