Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is ＞ 2000 pmol/min/ug.

Target Names

PLAU

Uniprot No.

A0A2K5WND1

Alternative Names

PLAU

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

21-430aa

Target Protein Sequence

SRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKQLVQECMVQNCADGKKPSSPPEELQFQCGQRTLRPRFKIVGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSTYNDPPFGTSCEITGFGKENSTDYLYPERLKMTVVKLVSHQKCQQPHYYGSEVTTKMLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPWIHSHTREENGLAL

Mol. Weight

47.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Urokinase-type plasminogen activator catalyzes the conversion of plasminogen to plasmin and plays a central role in extracellular matrix remodeling during tumor invasion and metastasis, making it a validated target in cancer biology. This full-length mature protein (aa 21–430) demonstrates robust catalytic function with a specific activity exceeding 2000 pmol/min/μg when activated by plasmin and measured using the chromogenic substrate Z-GGR-AMC, providing quantitative performance data that supports its use in kinetic parameter analysis (Km, Vmax, kcat/Km) and inhibitor screening campaigns to determine IC50 values for drug candidates. The C-terminal 10×His tag preserves access to the serine protease active site, ensuring that enzymatic activity remains uncompromised for substrate specificity profiling and inhibition mechanism studies. Purity greater than 95% by SDS-PAGE, combined with endotoxin levels below 1.0 EU/μg, meets the quality thresholds commonly required for accurate specific activity determination and serves as a reliable positive control in enzyme-linked assays investigating plasminogen activation pathways.

Code	CSB-MP6725MOV
Abbreviation	Recombinant Cynomolgus monkey PLAU protein (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is ＞ 2000 pmol/min/ug. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Urokinase-type plasminogen activator (PLAU) (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage