Home
Protein
Recombinant Proteins
Recombinant Measles virus Phosphoprotein (P/V), partial

Recombinant Measles virus Phosphoprotein (P/V), partial

^{In Stock}

Code	CSB-EP361049MCQ
Abbreviation	Recombinant Measles virus Phosphoprotein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

P/V

Uniprot No.

P03422

Research Area

Microbiology

Species

Measles virus (strain Edmonston) (MeV) (Subacute sclerose panencephalitis virus)

Source

E.coli

Expression Region

459-507aa

Target Protein Sequence

ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

21.1 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-KSI-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To generate a recombinant measles virus phosphoprotein with an N-terminal 6xHis-KSI tag in E. coli, follow these steps. First, clone the gene fragment encoding amino acids 459-507 of the measles virus phosphoprotein into an expression vector that allows for the addition of the 6xHis-KSI tag. Next, transform the recombinant vector into E. coli cells using a suitable method. Then, culture the transformed cells in a growth medium and induce protein expression using an inducer molecule like IPTG. After incubation, harvest the cells and lyse them to release the protein. Finally, purify and isolate the recombinant measles virus phosphoprotein from the cell lysate. The purity of the recombinant measles virus phosphoprotein is over 90%, as measured by SDS-PAGE. It appears as a band with a molecular weight of 22 kDa on the gel.