Home
Protein
Recombinant Proteins
Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB)

Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB)

^{In Stock}

Code	CSB-EP322515MFF
Abbreviation	Recombinant Methanothermus fervidus hmfB protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

hmfB

Uniprot No.

P19267

Research Area

Cancer

Alternative Names

hmfBDNA-binding protein HMf-2; Archaeal histone B

Species

Methanothermus fervidus

Source

E.coli

Expression Region

1-69aa

Target Protein Sequence

MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

11.7 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process for recombinant Methanothermus fervidus hmfB protein synthesis in e.coli cells includes recombining the DNA fragment that encodes the Methanothermus fervidus hmfB protein (1-69aa) into expression vector, transforming the recombinant vector into e.coli cells, screening positive cells, cultivating and inducing cells, conducting cell lysis, and performing expression analysis. The resulting recombinant Methanothermus fervidus hmfB protein is purified from the cell lysate using affinity purification, with its purity exceeding 90% as determined by SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils. Increases the resistance of DNA to thermal denaturation in vitro.

Subcellular Location

Cytoplasm. Chromosome.

Protein Families

Archaeal histone HMF family

Promotions