Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial

In Stock
Code CSB-YP333994MO
Abbreviation Recombinant Mouse Ly6g protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Ly6g was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Target Names
Ly6g
Uniprot No.
Research Area
others
Alternative Names
Ly6g; Lymphocyte antigen 6G; Ly-6G; Ly-6G.1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
27-119aa
Target Protein Sequence
LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Lymphocyte antigen 6G (Ly6g) is produced in a yeast expression system and features an N-terminal 6xHis-tag for simplified purification. This partial protein contains amino acids 27 to 119 and achieves a purity greater than 90%, as confirmed by SDS-PAGE analysis. The product is designed for research use only, maintaining a low endotoxin level suitable for various experimental applications.

Lymphocyte antigen 6G (Ly6g) appears to be primarily linked to the immune system in mice. Researchers often use it as a marker for identifying neutrophils in immunological studies. Its role in the immune response may make it a valuable component in research focused on inflammation, infection, and related pathways, though the mechanisms likely provide insight into the behavior and regulation of immune cells.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant mouse Ly6g protein fragment are unknown and must be considered highly uncertain. Ly6g is a GPI-anchored protein that typically forms a characteristic three-finger structure stabilized by multiple disulfide bonds. While expression in a yeast system (eukaryotic) is favorable for disulfide bond formation compared to bacterial systems, the protein is expressed as a partial fragment (27-119aa) with an N-terminal 6xHis tag, which could potentially interfere with proper folding. The high purity by SEC-HPLC (>90%) suggests a monodisperse preparation, but this does not confirm correct disulfide bond formation or native structure. Without validation, the protein's ability to bind its natural ligands or receptors cannot be assumed. Applications relying on specific biological interactions are speculative.

1. Antibody Development and Validation

This recombinant Ly6g fragment is suitable for use as an immunogen to generate antibodies. The high purity and His-tag facilitate purification and screening. However, it is critical to note that the antibodies generated will be against this specific fragment. Their ability to recognize the natively folded, full-length, GPI-anchored Ly6g protein on the surface of mouse neutrophils is uncertain and must be rigorously validated. The presence of the His-tag may also lead to tag-specific antibodies that don't recognize the native protein.

2. Protein-Protein Interaction Studies

The His-tagged recombinant Ly6g protein can be immobilized for pull-down assays. However, the utility for identifying physiological binding partners is highly questionable. Ly6g's function involves specific cell-surface interactions that depend on its correct three-finger structure and membrane context. This cytosolic fragment, likely lacking proper disulfide bonding, will not present native binding surfaces. Any interactions identified are likely to be non-specific artifacts.

3. Biochemical Characterization Assays

This purified recombinant Ly6g protein is well-suited for basic biochemical characterization, including molecular weight confirmation, stability studies, and assessment of its solution behavior. This application is valid as it focuses on intrinsic physical properties independent of native bioactivity. The data characterizes this recombinant Ly6g fragment, not the native membrane Ly6g protein.

Final Recommendation & Action Plan

The recommended course of action is to restrict the use of this protein lot to Applications 1 (antibody development with the explicit understanding that antibodies may not recognize native Ly6g) and 3 (biophysical characterization of the fragment itself). Before any functional studies can be considered, the protein's folding must be validated using techniques like circular dichroism to assess secondary structure and non-reducing PAGE to check for disulfide bond formation. For meaningful cell binding or interaction studies, a full-length or properly structured Ly6g protein would need to be produced in a system that supports correct disulfide bonding and presented in a membrane-like context. The immediate step is to validate folding, not proceed with functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please tell us the yeast strain used in CSB-YP333994MO?

A:

The yeast strain we use is GS115.

Target Background

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Expressed in bone marrow.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*