Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Ly6g; Lymphocyte antigen 6G; Ly-6G; Ly-6G.1
Species
Mus musculus (Mouse)
Expression Region
27-119aa
Target Protein Sequence
LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The construction of a plasmid coding for the Mouse Ly6g protein (27-119aa) is the initial step for the preparation of the recombiant Mouse Ly6g protein. The next is to transform the constructed plasmid into e.coli cells. e.coli cells containing the plasmid are screened and then cultured under conditions that promote the expression of the gene of interest. The protein is equipped with a N-terminal 10xHis tag. After that, affinity purification is used to isolate and purify the recombinant Ly6g protein from the cell lysate. Finally, the resulting recombinant Ly6g protein undergoes SDS-PAGE analysis, demonstrating a purity greater than 90%.