Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Ywhab; 14-3-3 protein beta/alpha; Protein kinase C inhibitor protein 1; KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha; N-terminally processed]
Species
Mus musculus (Mouse)
Expression Region
1-246aa
Target Protein Sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Ywhab covers amino acids 1-246. The calculated molecular weight for this Ywhab protein is 33.6 kDa. Expression of this Ywhab protein is conducted in e.coli. The N-terminal 10xHis tag was fused into the coding gene segment of Ywhab, making it easier to detect and purify the Ywhab recombinant protein in the later stages of expression and purification.
Mouse 14-3-3 protein beta/alpha (Ywhab) is a versatile regulator involved in diverse cellular processes. Ywhab interacts with phosphorylated target proteins, influencing their activity, localization, and stability. Its functions span signal transduction, cell cycle regulation, and apoptosis. Ywhab's versatility makes it a key player in maintaining cellular homeostasis and responding to environmental cues. The studies on Ywhab include intracellular signaling pathways, protein-protein interactions, and investigations into its impact on cellular functions. Understanding Ywhab's involvement in diverse processes contributes to insights into normal cellular physiology and provides potential avenues for therapeutic interventions in conditions where these processes are dysregulated.