Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Ywhab

Uniprot No.

Q9CQV8

Research Area

Neuroscience

Alternative Names

Ywhab; 14-3-3 protein beta/alpha; Protein kinase C inhibitor protein 1; KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha; N-terminally processed]

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

1-246aa

Target Protein Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.1 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-sumostar-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Introducing our Recombinant Mouse Ywhab protein, meticulously engineered for neuroscience researchers working with mouse models. This protein features the 14-3-3 protein beta/alpha, a critical component of numerous cellular signaling pathways and an essential participant in neuronal development and function. The full-length Ywhab protein with an expression range of 1-246aa ensures optimal functionality and consistency in your research endeavors.

Sourced from a yeast expression system, our Mouse Ywhab protein is fused with an N-terminal 6xHis-sumostar tag, enabling efficient purification and detection procedures. Boasting a purity greater than 85% as determined by SDS-PAGE, our recombinant protein is available in both liquid and lyophilized powder forms, catering to various experimental needs. Rely on our precision-crafted Recombinant Mouse Ywhab to deliver consistent and dependable results for your neuroscience research projects.

Target Background

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.

Gene References into Functions

Data indicate 14-3-3 beta protein as an interacting partner of type 1 cannabinoid receptor (CB1R). PMID: 25002257
the novel protein interaction mode in the 14-3-3beta.ChREBP alpha2 complex. PMID: 23086940
Studies suggest that insulin may modulate the cellular function of lipin-1 by regulating its subcellular localization through interactions with 14-3-3 proteins. PMID: 19955570
14-3-3 participates in the intracellular trafficking of IRS-1 PMID: 11875115
The transcription start site was identified and the polyadenylation signals (AATAAA) were found in exon 2 of the mouse gene. In the 5'-upstream sequence, we found three cis elements including a CRE sequence, a TATA box-like sequence, and a C/EBP element. PMID: 12008017
PRAS40 is a novel substrate of Akt, the phosphorylation of which leads to the binding of this protein to 14-3-3. PMID: 12524439
14-3-3beta is a p90 ribosomal S6 kinase (RSK) isoform 1-binding protein that negatively regulates RSK kinase activity PMID: 12618428
14-3-3beta gene plays a pivotal role in abnormal growth of tumor cells in vitro and in vivo. PMID: 12896901
These results indicate for the first time that 14-3-3 protein plays a critical anti-apoptotic role in diabetic myocardium by inhibiting the JNK pathway. PMID: 15240115
aldosterone increases the expression of 14-3-3beta, which interacts with phospho-Nedd4-2 to block its interaction with ENaC, thus enhancing sodium absorption by increasing apical membrane ENaC density PMID: 16613846
Cbl-b deficiency. Cbl-b deficiency resulted in increased phosphorylation of T758 in the beta2-chain of LFA-1 and thereby in enhanced association of 14-3-3beta protein with the beta2-chain PMID: 18239087
Akt1 is necessary for the growth factor stimulated activation of 14-3-3beta-Rac1-p21 activated kinase (Pak) pathway in endothelial cells and fibroblasts. PMID: 18853424

Hide All

Subcellular Location

Cytoplasm. Melanosome.

Protein Families

14-3-3 family

Database Links

KEGG: mmu:54401

STRING: 10090.ENSMUSP00000018470

UniGene: Mm.34319

Code	CSB-YP875120MOa4
Abbreviation	Recombinant Mouse Ywhab protein
MSDS	MSDS Datasheet
Size	US$368
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage