Recombinant Mouse 5-AMP-activated protein kinase catalytic subunit alpha-1 (Prkaa1), partial

Code CSB-EP707843MO1
Abbreviation Recombinant Mouse Prkaa1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
1-312aa
Target Protein Sequence
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse 5-AMP-activated protein kinase catalytic subunit alpha-1 (Prkaa1) is produced in E. coli and includes an N-terminal 6xHis tag that makes purification more straightforward. This partial protein spans amino acids 1-312 and comes with purity levels above 85%, as confirmed through SDS-PAGE analysis. The protein is intended for research purposes only and appears to meet strict quality standards for experimental work.

5-AMP-activated protein kinase (AMPK) acts as a central regulator of cellular energy homeostasis. It functions as an energy sensor within cells and likely plays a critical role in metabolic pathways through its ability to modulate enzyme activity in glucose and lipid metabolism. These characteristics make AMPK an important target for researchers studying metabolic disorders and energy regulation mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

AMPK is a heterotrimeric complex whose catalytic α-subunit requires correct folding, activation loop phosphorylation (at Thr172), and interaction with regulatory β/γ subunits for full bioactivity. The expressed fragment (1-312aa) contains the kinase domain but lacks critical C-terminal regions needed for regulatory subunit binding and complex assembly. E. coli cannot perform eukaryotic-specific phosphorylation, and the His tag may sterically hinder proper folding. While the kinase domain might fold independently, its enzymatic activity depends on upstream kinase phosphorylation (e.g., LKB1). Without co-expression of activating kinases or in vitro phosphorylation, the protein will likely be inactive. High purity does not guarantee correct folding or post-translational modification. Thus, this protein is probably misfolded/inactive without experimental validation.

1. In Vitro Kinase Activity Assays

This application is only feasible if the recombinant Prkaa1 is phosphorylated at Thr172 and correctly folded. Without activation, kinase assays will yield false-negative results. If activity is confirmed (e.g., via phosphorylation of substrates like SAMS peptide), the His tag facilitates immobilization for kinetic studies. However, the partial sequence lacks regulatory domains, limiting physiological relevance. Always include a positive control (e.g., commercially active AMPK).

2. Antibody Development and Validation

This recombinant Prkaa1 fragment is suitable as an immunogen for antibody production, as antibodies can target linear epitopes. The His tag simplifies purification for immunization. However, antibodies generated may not recognize native, full-length AMPK complexes due to conformational epitope differences or truncated sequence. Validate antibodies against full-length Prkaa1 from eukaryotic sources.

3. Structural and Biophysical Characterization

The protein is suitable for basic biophysical analyses (e.g., circular dichroism to assess secondary structure, dynamic light scattering to check aggregation). However, for structural studies (e.g., crystallography), the partial sequence and lack of phosphorylation may yield non-native conformations. The His tag could interfere with crystallization. Use tag-free, phosphorylated full-length protein for meaningful insights.

Final Recommendation & Action Plan

Before using this recombinant Prkaa1 fragment, validate its folding and phosphorylation status. First, check phosphorylation at Thr172 via Western blot with anti-pT172 antibodies. If unphosphorylated, perform in vitro phosphorylation using an upstream kinase (e.g., LKB1). Next, test kinase activity with a standard substrate (e.g., SAMS peptide). If inactive, limit use to non-functional applications like antibody production, but validate antibodies against native AMPK. For intraction studies, the partial Prkaa1 fragment cannot bind regulatory β/γ subunits (missing C-terminal domains), making interactions non-physiological. Misfolding may cause artifactual binding. Validate any interactions with full-length AMPK complexes from mammalian cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Regulates lipid synthesis by phosphorylating and inactivating lipid metabolic enzymes such as ACACA, ACACB, GYS1, HMGCR and LIPE; regulates fatty acid and cholesterol synthesis by phosphorylating acetyl-CoA carboxylase (ACACA and ACACB) and hormone-sensitive lipase (LIPE) enzymes, respectively. Regulates insulin-signaling and glycolysis by phosphorylating IRS1, PFKFB2 and PFKFB3. AMPK stimulates glucose uptake in muscle by increasing the translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane, possibly by mediating phosphorylation of TBC1D4/AS160. Regulates transcription and chromatin structure by phosphorylating transcription regulators involved in energy metabolism such as CRTC2/TORC2, FOXO3, histone H2B, HDAC5, MEF2C, MLXIPL/ChREBP, EP300, HNF4A, p53/TP53, SREBF1, SREBF2 and PPARGC1A. Acts as a key regulator of glucose homeostasis in liver by phosphorylating CRTC2/TORC2, leading to CRTC2/TORC2 sequestration in the cytoplasm. In response to stress, phosphorylates 'Ser-36' of histone H2B (H2BS36ph), leading to promote transcription. Acts as a key regulator of cell growth and proliferation by phosphorylating TSC2, RPTOR and ATG1/ULK1: in response to nutrient limitation, negatively regulates the mTORC1 complex by phosphorylating RPTOR component of the mTORC1 complex and by phosphorylating and activating TSC2. In response to nutrient limitation, promotes autophagy by phosphorylating and activating ATG1/ULK1. In that process also activates WDR45. In response to nutrient limitation, phosphorylates transcription factor FOXO3 promoting FOXO3 mitochondrial import. AMPK also acts as a regulator of circadian rhythm by mediating phosphorylation of CRY1, leading to destabilize it. May regulate the Wnt signaling pathway by phosphorylating CTNNB1, leading to stabilize it. Also has tau-protein kinase activity: in response to amyloid beta A4 protein (APP) exposure, activated by CAMKK2, leading to phosphorylation of MAPT/TAU; however the relevance of such data remains unclear in vivo. Also phosphorylates CFTR, EEF2K, KLC1, NOS3 and SLC12A1.
Gene References into Functions
  1. AMPK may be a critical regulator of fibroblast activation through regulation of cytoskeleton dynamics and myocardin-related transcription factor-A nuclear translocation, promoting renal fibrosis. PMID: 28739141
  2. these findings identify a previously uncharacterized role of folate/DHFR/AMPKalpha axis in regulating oligodendrocyte survival and myelination. PMID: 28496133
  3. CNR1 modulates AMPKalpha to influence insulin resistance and endoplasmic reticulum stress induced by palmitate. PMID: 29909009
  4. Inhibiting the LTB4/BLT1 signaling pathway via AMPK activation is a potential treatment strategy for septic cardiac dysfunction because it efficiently attenuates cardiac apoptosis, which may occur via the inhibition of inflammation and mitochondrial dysfunction. PMID: 28290498
  5. Thus, these findings suggest that AMPKalpha1 and AMPKalpha2 activity in chondrocytes is important in maintaining joint homeostasis and osteoarthritis development. PMID: 28225087
  6. At molecular analysis, there was a time-dependent nuclear translocation of the active phosphorylated catalytic subunits AMPKalpha1/alpha2 and PGC-1alpha in young, but not in mature, mice after sepsis. PMID: 28974562
  7. Low AMPK expression is associated with Acute respiratory distress syndrome. PMID: 30171880
  8. AMPK stabilizes FOXO3 and suggest a role in the first initiation step of mitochondrial segregation in muscle cells. PMID: 29580989
  9. these results demonstrate that AMPK downregulation is not a triggering factor in fatty liver development but in contrast, establish the therapeutic impact of pharmacological AMPK re-activation in the treatment of fatty liver disease. PMID: 29343420
  10. Prkaa1 deletion activates skeletal muscle mTOR signalling, which has a central role in lipid metabolism and mitochondrial oxidation. Collectively, our study provides new insights into the role of Prkaa1 in skeletal muscle PMID: 29288408
  11. our findings suggest that the role of Cx43 in response to H2O2 stress is dependent on the activation of AMPK signaling pathways and regulates ROS production and cell necrosis. PMID: 29279848
  12. activation of AMPK at early stage of adipogenesis is involved in the anti-adipogenesis effect of Red Pepper Seed extract. PMID: 29316805
  13. Study indicate that the alpha 2 and alpha 1 subunits of AMPK have several functional differences, with alpha 2 conferring stronger osteogenic potential and a weaker ability to induce osteoblasts-associated osteoclastogenesis in MC3T3-E1 cells as well as conferring a lower adipogenic potential to 3T3-L1 cells. PMID: 27600021
  14. Over-expression of AMP-activated protein kinase (AMPK) promoted the apoptosis of mesangial cells from the systemic lupus erythematosus (SLE) mice. PMID: 29268850
  15. AMPK-PGC-1a control of mitochondrial reactive oxygen species regulates Warburg metabolism. PMID: 28978464
  16. AMPKalpha1 has a critical role in maintaining the anticontractile actions of perivascular adipose tissue; an effect independent of the endothelium but likely mediated through altered adiponectin secretion or sensitivity. PMID: 27668984
  17. Ampk-/- mice displayed retardation of postnatal bone development, although bone deformity was not observed at birth. PMID: 29126229
  18. Cardiac SUR2A levels were significantly increased while Kir6.2 levels were not affected. Hypoxia did not induce phosphorylation of extracellular signal-regulated kinases (ERK1/2) or protein kinase B (Akt), but triggered phosphorylation of AMP activated protein kinase (AMPK). AICAR, an activator of AMPK, increased the level of SUR2A in H9c2 cells. We conclude that oxygen increases SUR2A level by activating AMPK. PMID: 28121062
  19. This study provides new insights into the control of eEF2K by AMPK. PMID: 28502587
  20. These data indicate that a reduction in AMPK disrupts cellular metabolism in both progenitors and differentiated placental trophoblasts. PMID: 28335680
  21. Targeted activation of AMPK by GSK621 ameliorates H2O2-induced osteoblast cell injuries. PMID: 28060740
  22. Sestrin 1 targets at the AMPK/mTORC1/autophagy pathway to inhibit cardiac hypertrophy by interaction with AMPK which is responsible for autophagy regulation. Taken together, our data indicate that Sestrin 1 regulates AMPK/mTORC1/autophagy axis to attenuate cardiac hypertrophy. PMID: 28181410
  23. AMPK enhances intestinal barrier function and epithelial differentiation via promoting CDX2 expression, which is partially mediated by altered histone modifications in the Cdx2 promoter. PMID: 28234358
  24. our results elucidate a previously unrecognized role of AMPKalpha1 deletion in loss of contact inhibition of cellular proliferation and angiogenesis PMID: 27449088
  25. AMPK and Sirt2 control compensatory glucose uptake in metabolically arrested mitochondria. PMID: 27909079
  26. results indicate that liver AMPKalpha1alpha2 is required for maintaining glucose homeostasis during an acute bout of exercise. PMID: 29038293
  27. AMP-activated protein kinase (AMPK) regulates autophagy by phosphorylating BECN1 at Thr388 PMID: 27304906
  28. activation of AMPK might be a stress response of host cells to restrict virus production through promotion of autophagic degradation PMID: 27305174
  29. AMPK regulates T cell survival and function. Demonstrate AMPK-dependent and independent rolesof AICAR/Compound C in regulating T cell responses. PMID: 27177226
  30. AMPK was sufficient to stimulate osteogenesis of MC3T3-E1 cells and inhibit adipogenesis of 3T3-L1 cells through the AMPK-Gfi1-OPN axis. PMID: 27283242
  31. AMPK activation reduces the formation of atheromata-inducing macrophages in ApoE(-/-)-deficient mice by inhibiting expression of Ccr2, thereby preventing the Ccr2-mediated migration of Ly6C(hi) monocytes from the bone marrow. PMID: 28235712
  32. AMPK activation inhibited IL-1beta-stimulated CXCL10 secretion, associated with reduced interleukin-1 receptor associated kinase-4 (IRAK4) phosphorylation. PMID: 27840174
  33. Findings indicate that the energy-sensing LKB1-AMPK pathway regulates IGF1 secretion in mouse primary hepatocytes, which in turn regulates activation of the IGF1R-PKB pathway. PMID: 28500773
  34. These data suggest that nutrient availability dictates the mode of division and that LKB1-AMPK mediates this nutrient-driven effect on intestinal epithelial stem cell proliferation. PMID: 28766983
  35. Myeloid-Restricted AMPKalpha1 Promotes Host Immunity and Protects against IL-12/23p40-Dependent Lung Injury during Hookworm Infection PMID: 27183598
  36. Data suggest that Il4 (usually released from helper T-cells) induces Cox1 in macrophages at post-transcriptional level; activation of Ampk (catalytic subunit Prkaa1) by metformin blocks Il4-dependent induction of Cox1 and blocks macrophage polarization/activation. (Il4 = interleukin-4; Cox1 = cyclooxygenase 1; Ampk = AMP-activated protein kinase) PMID: 28684424
  37. The metformin-rescued P23H rhodopsin was still intrinsically unstable and led to increased structural instability of the rod outer segments. These data suggest that improving the traffic of misfolding rhodopsin mutants is unlikely to be a practical therapy, but also highlights the potential of altering translation through AMPK to improve protein function in other protein misfolding diseases PMID: 28065882
  38. Mechanistically, miR-499 directly targets Fnip1, an AMP-activated protein kinase (AMPK)-interacting protein that negatively regulates AMPK, a known activator of PGC-1alpha. This miR-499/Fnip1/AMPK circuit can serve as a mechanism to couple muscle fiber type and mitochondrial function. PMID: 27506764
  39. dopamine is coupled to AMPK activation, which provides a substantial anti-inflammatory and bioenergetic advantage and reduces the severity of endotoxin-induced acute lung injury. PMID: 27733575
  40. AMPKalpha1 deficiency suppresses brown adipogenesis in favor of fibrogenesis during brown adipose tissue development. PMID: 28668388
  41. AMPK-dependent metabolic repair mechanisms are important for mitigating lung injury. PMID: 28085510
  42. these data demonstrated that LKB1/AMPK signaling pathway activation improved the survival of diabetic mice complicated with endotoxemia. Thus, LKB1/AMPK signaling pathway may serve as a potentially useful therapeutic target for severe infection in diabetic patients. PMID: 28628912
  43. We confirmed that procyanidins suppressed acute hyperglycemia with an oral glucose tolerance test in a dose-dependent manner.procyanidins, especially cinnamtannin A2, significantly ameliorate postprandial hyperglycemia at least in part by promoting GLUT4 translocation to the plasma membrane by activating both insulin- and AMPK-signaling pathways. PMID: 27598258
  44. These findings demonstrate that the AMPK-TBC1D1 signaling nexus interacts with the PKB-mTOR pathway via IGF1 secretion, which consequently controls expression of lipogenic genes in the adipose tissue PMID: 27307439
  45. AMPKa1 deficiency impairs autophagy-mediated monocyte differentiation and decreases monocyte/macrophage survival PMID: 28330873
  46. The authors identified lactate dehydrogenase (LDH) as a new functional target of AMPKalpha1. PMID: 28515121
  47. AMPKalpha1 knockout (KO) mice exhibit normal renal sodium handling and a moderate antidiuretic state. This is accompanied by higher urinary aldosterone excretion rates and reduced blood pressure. Plasma volume, however, was found to be increased compared with wild-type mice. PMID: 28179232
  48. AMPK in adipocytes is vital for maintaining mitochondrial integrity. PMID: 27411013
  49. Study demonstrated that adenosine monophosphate-activated protein kinase alpha 1 (AMPKalpha1) is imperative for maintaining normal nociception, and mice deficient for AMPKalpha1 exhibit mechanical allodynia. PMID: 27058143
  50. The data suggest that AMPK is not required for the regulation of the intermediate filament interaction with CPT-I during exercise. PMID: 27941154

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=In response to stress, recruited by p53/TP53 to specific promoters.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*