Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial

In Stock
Code CSB-BP013104MO1
Abbreviation Recombinant Mouse Lrpap1 protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
Heparin-binding protein 44 (HBP-44) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP)
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
248-360aa
Target Protein Sequence
GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Mouse Lrpap1 protein expression involves transfecting baculovirus cells with a DNA expression vector containing the gene encoding the recombinant protein of interest (248-360aa) and then culturing the cells so that they express the desired protein. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The recombinant Mouse Lrpap1 protein is collected and purified from the cell lysate through affinity purification. Its purity is greater than 85%, as measured by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.
Gene References into Functions
  1. RAP deficiency attenuated atherosclerosis without influencing abdominal aortic aneurysms in hypercholesterolemic mice infused with angiotensin II. PMID: 22153700
  2. Findings reveal that RAP is a novel Abeta-binding protein that promotes cellular internalization of Abeta. PMID: 19826010
  3. In RAP-deficient mice megalin expression was strongly reduced and restricted to a subapical localization and NaP(i)-IIa protein distribution and abundance in the kidney was not altered. PMID: 12748857
  4. the His-sRAP-induced acceleration of megalin-mediated endocytosis causes phosphaturia via altered subcellular distribution of NaPi-II [39-kD receptor-associated protein (RAP)] PMID: 15976002
  5. Results suggest that receptor-associated protein is required for the establishment of thyroglobulin reservoirs, but its absence does not affect hormone secretion. PMID: 16306127
  6. RAP is expressed by thyrocytes in a TSH-dependent manner, both in cultured thyroid cells and in vivo PMID: 17123336
  7. Disruption of the RAP gene determines not only thyroid abnormalities, but also a severe defect of megalin expression and function in the kidney. PMID: 18296906
  8. Receptor-associated protein (RAP) plays a central role in modulating Abeta deposition in APP/PS1 transgenic mice PMID: 18776935

Show More

Hide All

Subcellular Location
Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface.
Protein Families
Alpha-2-MRAP family
Tissue Specificity
Highly expressed in PYS-2 parietal endoderm cells and in the kidney. The RNA level increased about 10-fold during differentiation of F9 embryonal carcinoma cells to parietal endoderm cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*