Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Lrpap1

Uniprot No.

P55302

Research Area

Metabolism

Alternative Names

Heparin-binding protein 44 (HBP-44) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP)

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

248-360aa(H294F,H296F,Y297C,H305F)

Target Protein Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.2 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our meticulously designed Recombinant Mouse Lrpap1 protein is perfect for researchers working in the field of metabolism. This protein features the Alpha-2-macroglobulin receptor-associated protein, also known as Alpha-2-MRAP and Heparin-binding protein 44, which plays a vital role in the regulation of cellular uptake of various ligands and the clearance of extracellular proteases.

Expressed in a Baculovirus system, our Mouse Lrpap1 protein encompasses a partial sequence covering amino acids 248-360 with four amino acid substitutions (H294F, H296F, Y297C, and H305F) for optimal protein stability and functionality. The N-terminal 10xHis-tag and C-terminal Myc-tag ensure ease of purification and detection, streamlining your research experience.

With a purity greater than 85% as determined by SDS-PAGE, our recombinant Lrpap1 protein is available in both liquid and lyophilized powder forms to accommodate various research needs. Trust our Recombinant Mouse Lrpap1 protein for consistent and reliable results in your metabolism-focused studies.

Target Background

Function

Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.

Gene References into Functions

RAP deficiency attenuated atherosclerosis without influencing abdominal aortic aneurysms in hypercholesterolemic mice infused with angiotensin II. PMID: 22153700
Findings reveal that RAP is a novel Abeta-binding protein that promotes cellular internalization of Abeta. PMID: 19826010
In RAP-deficient mice megalin expression was strongly reduced and restricted to a subapical localization and NaP(i)-IIa protein distribution and abundance in the kidney was not altered. PMID: 12748857
the His-sRAP-induced acceleration of megalin-mediated endocytosis causes phosphaturia via altered subcellular distribution of NaPi-II [39-kD receptor-associated protein (RAP)] PMID: 15976002
Results suggest that receptor-associated protein is required for the establishment of thyroglobulin reservoirs, but its absence does not affect hormone secretion. PMID: 16306127
RAP is expressed by thyrocytes in a TSH-dependent manner, both in cultured thyroid cells and in vivo PMID: 17123336
Disruption of the RAP gene determines not only thyroid abnormalities, but also a severe defect of megalin expression and function in the kidney. PMID: 18296906
Receptor-associated protein (RAP) plays a central role in modulating Abeta deposition in APP/PS1 transgenic mice PMID: 18776935

Hide All

Subcellular Location

Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface.

Protein Families

Alpha-2-MRAP family

Tissue Specificity

Highly expressed in PYS-2 parietal endoderm cells and in the kidney. The RNA level increased about 10-fold during differentiation of F9 embryonal carcinoma cells to parietal endoderm cells.

Database Links

KEGG: mmu:16976

STRING: 10090.ENSMUSP00000030986

UniGene: Mm.277661

Code	CSB-BP013104MO1(M)
Abbreviation	Recombinant Mouse Lrpap1 protein (H294F,H296F,Y297C,H305F), partial
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage