Recombinant Mouse Alpha-hemoglobin-stabilizing protein (Ahsp)

In Stock
Code CSB-EP875156MO
Abbreviation Recombinant Mouse Ahsp protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Ahsp
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Erythroid differentiation-related factor;Erythroid-associated factor
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-102aa
Target Protein Sequence
MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation.
Gene References into Functions
  1. role of alpha-hemoglobin stabilizing protein in hemoglobin assembly PMID: 22287545
  2. Endogenous AHSP is not limiting for alpha-globin detoxification in beta-thalassemic mice. PMID: 20815047
  3. An abundant erythroid protein that stabilizes free alpha-haemoglobin. PMID: 12066189
  4. activin A does not appear to affect the exocrine or endocrine components of the pancreas, but promotes differentiation of pancreatic tissue into intestine via a Shh-dependent mechanism PMID: 15054113
  5. Loss of AHSP impairs erythropoiesis and exacerbates beta-thalassemia. PMID: 15545996
  6. These results support the hypothesis that EKLF acts as a transcription factor and a chromatin modulator for the AHSP and beta-globin genes and indicate that EKLF may play similar roles for other erythroid genes. PMID: 16705186
  7. developmental stage- and differentiation state-specific regulation of the nuclear transport of EKLF might be one of the steps necessary for the switch-on of the mammalian adult beta globin gene transcription PMID: 17242208
  8. AHSP also acts as a molecular chaperone to stabilize nascent alpha-globin for hemoglobin A assembly PMID: 17607360
  9. The expression of AHSP in a subclone of murine erythroleukemia cells in relationship to prion protein on the cell surface is reported. PMID: 18828445

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
AHSP family
Tissue Specificity
Expressed in spleen, bone marrow, and blood, with highest levels in bone marrow.
Database Links

KEGG: mmu:170812

UniGene: Mm.423023

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*